Details for Chinese cabbage Locus Brara.A03547

Position : A01 ( 5`- 28818480 .. 28819001 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03547

Protein [Map View]
MANIKNPKNVDDDSDRISRNSHQSVDNSLSRSYLCSFCVRGFSNAQALGGHMNIHRRDRANLRQRLMEDHKDDVVAESDH
PSEGISLDLNEKQQQQDAFTCEDDDQNQDVEKDISPGKKLGFWVQESKIDTTNDDEKVTEVGIDGSSSSHHGEIEGLDLE
LRLGQSAGEKKTT*

DNA
ATGGCAAACATCAAAAACCCTAAAAACGTGGATGATGATTCCGATCGCATTTCAAGAAACAGTCATCAAAGCGTTGATAA
CTCTCTGTCAAGATCTTACTTATGCAGTTTCTGCGTAAGGGGCTTCTCGAATGCTCAAGCACTAGGAGGACATATGAACA
TCCACAGAAGAGACAGAGCTAATCTCAGACAAAGGCTTATGGAAGATCACAAGGATGATGTTGTAGCGGAGAGTGATCAT
CCATCAGAAGGTATCTCTCTAGACCTTAATGAAAAACAACAACAACAAGACGCCTTTACATGTGAAGATGATGATCAAAA
TCAAGATGTGGAAAAAGATATAAGTCCTGGTAAGAAATTAGGGTTTTGGGTTCAAGAAAGCAAGATTGATACTACTAATG
ATGATGAAAAAGTCACGGAGGTTGGCATAGATGGTTCGAGTTCGAGTCATCATGGTGAGATTGAAGGATTGGATCTTGAG
CTCCGGTTAGGCCAAAGCGCCGGGGAGAAGAAGACAACATAA