Details for Chinese cabbage Locus Brara.A03530

Position : A01 ( 5`- 28675948 .. 28678626 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03530

Protein [Map View]
MSCDLNPPPDEEVKMEDECVENKQSRAAASCSSVSEGSSGGSSSFLKSPPAVASPPPTASPTPRRTSGPIRRAKGGWTPE
EDETLRQAVCKFNGKSWKKIAEFFPDRTEVQCLHRWQKVLNPDLIKGPWTQQEDEKIIELVEKYGPAKWSIISDSLPGRI
GKQCRERWHNHLNPGINKDAWTPEEELALMNAHQVHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKSEFLLANGSLPPAA
ATNGVPSCFQRRLSVSVAQTSSGRTQINKPREEVAAASPMAGFEEYVRSSQLPKPEPSPENGYHLNNKKPQPEDHHMASE
ADKQRMYGYECGCSPSASSPVIFFTPPPPSREEYSSNGSAPRSPESFLREAARTFPNTPSIFRKRRRKAVVVPDNNKTDE
EEAAKEVVDEKVNGISETLDCEEKENSGSNAYNLSPPYRIRSKRTAVFKSRQLEFISPEEEKVDDETKSSEKDKLLDGGD
SQLSGQEK*

DNA
ATGAGCTGCGATTTGAATCCACCTCCAGATGAGGAAGTGAAAATGGAGGATGAGTGTGTAGAGAATAAGCAATCAAGAGC
TGCTGCTTCTTGCTCCTCTGTATCTGAAGGCAGCAGTGGTGGTAGTAGTAGTTTCCTCAAGTCACCTCCTGCTGTTGCAA
GTCCTCCTCCCACTGCATCTCCAACTCCTAGGAGGACGAGTGGCCCTATAAGGAGAGCCAAAGGTGGGTGGACACCGGAA
GAGGATGAGACATTGAGACAAGCAGTTTGTAAGTTTAATGGCAAGAGCTGGAAGAAAATAGCGGAGTTTTTCCCTGATAG
AACTGAAGTTCAGTGCCTGCACCGTTGGCAGAAAGTTTTGAATCCGGACCTTATCAAAGGACCTTGGACACAACAGGAGG
ATGAGAAGATCATTGAACTTGTTGAAAAATACGGGCCTGCGAAATGGTCTATCATCTCAGACTCTTTACCAGGTAGAATT
GGGAAGCAATGTCGAGAGAGGTGGCACAACCATTTGAATCCTGGCATCAACAAGGATGCTTGGACTCCAGAGGAAGAGTT
AGCTCTCATGAATGCTCATCAAGTCCACGGAAACAAATGGGCTGAGATTGCTAAGGTCTTACCCGGCAGAACCGACAATT
CGATAAAGAACCACTGGAACAGTTCACTGAAGAAGAAGTCAGAGTTCCTCTTAGCTAACGGTAGCTTACCACCGGCAGCA
GCAACGAACGGTGTTCCATCTTGTTTTCAGAGAAGGCTTTCTGTTTCAGTTGCTCAAACCTCTTCGGGAAGAACACAGAT
TAACAAGCCCCGTGAAGAAGTAGCTGCTGCTTCGCCAATGGCTGGTTTTGAAGAGTACGTTCGTTCTTCTCAGTTGCCTA
AACCAGAGCCATCGCCAGAGAATGGTTATCATCTTAACAACAAGAAGCCTCAACCAGAGGATCATCACATGGCGTCAGAA
GCGGATAAGCAGCGGATGTATGGGTATGAATGTGGTTGCAGCCCAAGCGCATCATCACCTGTTATCTTCTTCACTCCACC
ACCGCCTAGTAGAGAAGAGTACAGTAGTAACGGTTCAGCTCCAAGGAGTCCTGAATCTTTTTTGAGAGAAGCTGCTAGAA
CATTCCCAAACACCCCTTCTATATTCAGGAAAAGACGACGCAAGGCTGTTGTTGTTCCGGATAACAACAAAACAGATGAA
GAAGAAGCTGCTAAAGAGGTTGTTGATGAAAAGGTGAATGGTATCTCAGAAACCCTTGACTGTGAAGAGAAGGAGAACAG
TGGATCAAATGCTTACAACTTATCTCCTCCGTACCGGATAAGATCGAAAAGAACAGCTGTTTTTAAGTCAAGACAGCTTG
AGTTCATCTCTCCAGAGGAAGAGAAAGTTGATGATGAAACCAAATCATCTGAGAAAGATAAGTTGCTTGATGGTGGAGAT
TCTCAACTCTCAGGCCAAGAAAAATGA