Details for Chinese cabbage Locus Brara.A03528

Position : A01 ( 5`- 28673801 .. 28674561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03528

Protein [Map View]
MSCCGGNCGCGSGCKCGSGCGGCNMYPNLTFSDETTTTNTSVFGLAPAMKNQYEASGEGNAENDACKCGSDCKCDPCTCK
*

DNA
ATGTCTTGCTGTGGAGGAAATTGTGGTTGTGGATCAGGCTGCAAATGCGGCAGCGGATGCGGAGGTTGCAACATGTACCC
GAACTTGACCTTTTCCGACGAGACGACCACAACTAATACTTCTGTCTTTGGCCTTGCACCGGCGATGAAGAACCAGTACG
AGGCTTCCGGCGAGGGTAACGCTGAGAACGATGCATGCAAGTGTGGCTCTGACTGCAAGTGTGACCCTTGCACCTGTAAA
TGA