Details for Chinese cabbage Locus Brara.A03524

Position : A01 ( 5`- 28652569 .. 28656975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03524

Protein [Map View]
MSLVGRVGSLISQGVYSVATPFHPFGGAIDVIVVQQEDGSFRSTPWYVRFGKFQGVLKGAEKFVKISVNGDEADFHMYLD
NSGEAYFIREVDPETTNDLISSSEDSNGSERVLTLEHSSSDVGAGELREGLSSLNRLDRTESDSNGRYYDFQDDPPSPTS
EYGSARFDNLNVESYGDSSPGLDSEVVLVSVDGHILTAPVSAEEQEAENLRLNTPQFHLAPGDGTEFCEGSTEFTSSETS
WDTEFISKVESSNAVVNIESKKVDIGCVECNDENAKSEEAASTLEVQNLKEGELVPTTITESVRGEDEVAIVGSCLEQSE
EAASNFEVQNLKEGELVPIETVTTLVDGSESSTTQLTTEEVKTPEESNTELECEDEETSPSAETAILIENKEGEIIESEE
RVSVDSTREEDEQLTPSKEPEEDNENKNTTESVAETSNIARSETELKYELSLCKDELRQGMGLTAAAEVFNTHLISTEEY
KNSATSILESENLVVRIRETYMPWKKAARIVLGKVVFDLDLEIQPEDVISVEETKPKDDETAAVTTSPSSSGRRWRLWPI
PFRRVKTVEHTTSSNSSSEEDLFVDSEPGLQNSPEVLSTNESPRRQLVRTNVPTNEQIASLNLKDGQNMITFSFSTRVLG
TQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQFMPLVGRDWTQSGVAKLFSAIKENGYQLLFLSARAIVQAYLTRSFL
NNLKQDGKALPNGPVVISPDGLFPALYREVIRRAPHEFKIACLEDIKKLFPEHYNPFYAGFGNRDTDELSYSKLGIPKGK
IFIINPKGEVATGHRVDVKKSYTSLHTLVNDMFPPTSLVEQEDYNPWNFWKLPIEEVD*

DNA
ATGAGTTTGGTCGGGAGAGTTGGGAGCTTGATTTCCCAAGGAGTATACTCCGTCGCTACACCGTTTCACCCCTTCGGTGG
CGCCATTGACGTCATCGTCGTCCAACAAGAAGACGGTTCCTTCCGTAGCACTCCCTGGTACGTTAGGTTCGGCAAGTTCC
AAGGCGTCCTCAAGGGGGCTGAGAAGTTTGTGAAGATCTCCGTGAATGGCGATGAAGCTGACTTCCACATGTATCTTGAT
AACTCCGGTGAAGCTTATTTCATCAGAGAAGTTGATCCTGAAACCACCAACGATCTGATCTCTAGCTCTGAGGATAGCAA
CGGTAGTGAGAGGGTTTTGACTCTTGAGCATAGCTCGTCCGACGTTGGCGCTGGAGAGTTGAGAGAGGGTTTAAGCTCTT
TGAACCGGCTTGATAGGACGGAGTCTGATAGTAACGGGAGGTATTATGATTTTCAGGATGATCCTCCTTCTCCTACGTCC
GAGTATGGGAGTGCTCGGTTTGATAATTTGAATGTGGAGAGCTATGGAGATTCTTCTCCGGGTTTAGATTCTGAGGTGGT
TTTGGTGAGTGTTGACGGTCATATACTAACGGCTCCTGTCTCGGCTGAGGAGCAGGAGGCTGAGAATTTGAGGTTGAATA
CTCCTCAGTTTCATTTGGCTCCTGGTGATGGGACTGAGTTTTGTGAAGGGAGTACTGAGTTTACTTCCTCTGAGACTTCA
TGGGATACTGAGTTTATCAGCAAAGTGGAGTCATCTAATGCTGTAGTTAATATTGAATCTAAAAAAGTAGACATTGGTTG
TGTTGAGTGTAATGATGAGAATGCTAAATCTGAGGAGGCAGCTTCTACTCTTGAGGTTCAGAATCTAAAAGAAGGTGAGC
TTGTACCTACCACCATCACAGAAAGTGTTAGAGGTGAAGATGAAGTGGCTATTGTTGGGAGCTGTTTGGAGCAGTCTGAG
GAGGCAGCTTCTAATTTTGAGGTTCAGAATCTAAAAGAAGGTGAGCTTGTGCCTATTGAAACAGTAACTACTCTTGTTGA
TGGTTCTGAATCTTCTACAACTCAACTAACAACAGAAGAAGTGAAAACACCTGAGGAATCTAATACGGAGTTAGAATGTG
AAGATGAAGAGACAAGTCCTTCTGCAGAAACTGCCATCTTGATTGAGAACAAAGAAGGCGAGATTATAGAGTCAGAAGAG
AGAGTCTCTGTAGATTCAACGAGAGAGGAAGATGAGCAACTAACTCCATCTAAAGAGCCTGAGGAGGATAACGAGAACAA
GAACACAACGGAATCAGTGGCTGAGACTTCTAACATTGCAAGATCCGAAACAGAACTGAAATATGAGCTATCACTTTGCA
AGGACGAGCTTCGTCAAGGCATGGGACTCACCGCAGCAGCTGAAGTCTTTAACACACATCTCATCTCTACAGAAGAGTAT
AAAAACTCAGCAACATCAATCCTCGAAAGCGAGAATCTAGTCGTTAGGATCAGAGAAACATACATGCCATGGAAGAAAGC
TGCTAGAATCGTGCTTGGAAAGGTTGTGTTCGATCTAGACTTAGAGATTCAGCCAGAAGATGTGATCTCTGTGGAGGAAA
CCAAACCAAAGGACGATGAAACCGCTGCAGTAACAACATCTCCTTCTTCCTCTGGAAGAAGGTGGAGACTCTGGCCTATT
CCTTTTAGGAGGGTGAAAACGGTCGAGCATACGACGAGTAGTAACTCATCTAGCGAAGAGGATCTGTTTGTTGACTCTGA
GCCTGGATTGCAGAACTCGCCGGAAGTGCTGTCAACCAATGAGTCTCCACGTAGACAGCTTGTGAGAACTAATGTTCCTA
CTAATGAGCAGATTGCGTCACTGAATTTGAAAGATGGTCAGAATATGATTACTTTTAGTTTCTCCACGAGAGTTCTTGGA
ACACAACAGGTTGATGCACATATCTACAGGTGGAGATGGGACACCAAGATTGTGATTTCAGATGTTGATGGGACTATAAC
TAAATCTGATGTGTTAGGTCAGTTCATGCCTTTGGTTGGAAGGGACTGGACACAGTCTGGTGTGGCCAAGCTTTTTTCAG
CTATAAAGGAGAATGGATACCAGCTGCTGTTTCTTAGCGCTCGTGCCATTGTTCAGGCATATCTAACAAGAAGTTTCTTA
AATAATCTAAAGCAGGACGGAAAAGCTCTACCAAACGGTCCTGTAGTCATTTCACCAGACGGGCTGTTTCCAGCATTGTA
CCGTGAAGTGATAAGAAGAGCACCTCACGAATTCAAGATCGCATGTTTGGAGGATATCAAGAAGCTTTTCCCAGAGCACT
ATAACCCGTTCTACGCTGGATTTGGAAACAGAGACACTGATGAGCTGAGTTACAGCAAACTCGGGATCCCCAAGGGAAAA
ATATTCATAATCAACCCAAAGGGAGAGGTAGCAACAGGACATCGAGTAGATGTCAAGAAGTCTTACACATCACTTCATAC
TCTTGTCAACGACATGTTTCCTCCAACTTCCCTTGTTGAGCAGGAAGATTATAACCCATGGAACTTCTGGAAACTACCAA
TAGAAGAGGTTGACTGA