Details for Chinese cabbage Locus Brara.A03521

Position : A01 ( 5`- 28636717 .. 28638677 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03521

Protein [Map View]
MVKKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDKKTKTGGPFGTIRLPQELADDANKGLDIAVR
LLEPIKDLFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLREVFGRMGLNDKDIVALS
GGHTLGRCHKERSGFEGPWTQDPLIFDNSYFKELLSGEKQGLLQLPTDKALLEDPIFRPLVERYAADEDAFFEEYTKAHL
KLSELGFADKE*

DNA
ATGGTGAAGAAGAGTTACCCGGAAGTGAAGGAAGAGTACAAGAAAGCTGTTCAGAGATGCAAGAGAAAGCTCCGTGGTCT
TATCGCCGAGAAGCACTGTGCTCCCATCGTTCTCCGTCTTGCATGGCACTCGGCTGGTACATTTGACAAGAAGACGAAGA
CGGGAGGACCGTTTGGGACGATAAGGCTTCCACAAGAGCTAGCTGATGATGCTAACAAAGGTCTTGATATTGCTGTCAGG
CTTCTTGAGCCTATCAAGGACTTGTTCCCCATCTTGTCCTACGCTGATTTTTACCAGTTAGCTGGAGTTGTTGCTGTTGA
GATCACTGGAGGACCCGAGATTCCTTTTCATCCTGGTAGATTGGATAAAGTTGAGCCACCTCCTGAAGGGCGTCTACCTC
AGGCCACCAAAGGGGTGGATCATCTGAGAGAGGTATTTGGTCGGATGGGACTCAATGACAAAGATATTGTTGCACTGTCT
GGTGGACACACCTTGGGTCGGTGCCACAAGGAACGCTCCGGATTCGAAGGGCCGTGGACACAAGATCCTCTCATTTTTGA
CAACTCTTATTTCAAAGAGTTACTAAGCGGAGAGAAACAAGGACTTCTTCAACTTCCAACCGACAAGGCTCTCCTCGAGG
ATCCTATCTTTCGTCCTCTTGTTGAGAGATATGCTGCAGATGAGGATGCCTTCTTCGAAGAGTATACTAAAGCTCATCTC
AAGTTGTCGGAACTCGGGTTTGCTGACAAGGAGTAA