Details for Chinese cabbage Locus Brara.A03516

Position : A01 ( 5`- 28623200 .. 28625471 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03516

Protein [Map View]
MVKKAKWLKNVKKAFSQDLKKLKHKSVEYQNSEISYPVLVASSRSSPPQFEVRVDKVKRKKNLFPPPPPPLPPPPEEEEE
EDVIVDSPRSSPEFVPQAAKPTRFPGEDAAAIFIQSIFRGHLARRESQGMRRLARLKLLMEGSVVQRQAAHTLKCMQTLT
RLQSQIRSRRIRMSEENQARHKQLLHKHAKELGGLKSGGNWNDSNQSKDQIEAGLLNKYEATMRRERALAYAFTHQQHLK
GNMRSGNTMFMDPSNPTWGWSWLERWMADKPWESSEKEQSKKEKSSVKTSTSRNSHGVETTKPSNRKKLTSLTQPNVPSS
SSSLSTSRNPRKTKPTPSSIKSKTTDEITKSSDRKHSIARSAVSDDEGLASSTARRRNTVPTKPTRGKLKGQSSSGVSAA
NTATTEENNEKAPIKKRVSTAPKPRKSSAPPNSILKKVGTPSD*

DNA
ATGGTCAAGAAAGCGAAATGGCTGAAGAACGTTAAGAAGGCTTTTAGCCAAGATTTAAAGAAACTGAAACATAAATCGGT
TGAGTATCAGAATAGTGAGATCTCTTATCCTGTATTGGTAGCTTCATCCAGAAGTTCTCCTCCTCAGTTTGAGGTCAGAG
TTGATAAGGTCAAACGTAAGAAGAATCTCTTCCCTCCTCCTCCTCCTCCCCTTCCTCCTCCTCCAGAAGAAGAAGAAGAA
GAAGATGTTATTGTAGATTCGCCTCGATCTTCTCCTGAGTTTGTTCCTCAAGCAGCTAAACCTACCAGGTTTCCAGGGGA
AGACGCAGCTGCCATCTTTATCCAGTCTATATTTAGAGGACATTTGGCAAGAAGAGAGTCCCAGGGGATGAGGAGGTTGG
CCAGGCTTAAGTTACTGATGGAAGGATCAGTTGTACAGCGGCAAGCTGCACATACACTTAAATGTATGCAGACTCTCACT
CGCTTGCAGTCACAGATCCGGTCTAGGAGAATCAGGATGTCAGAAGAGAACCAGGCTCGCCATAAGCAACTTCTTCATAA
ACATGCCAAAGAGCTAGGAGGCTTGAAGAGTGGGGGTAATTGGAATGATAGCAATCAGTCCAAGGATCAAATCGAAGCAG
GTTTGTTGAATAAGTACGAGGCGACGATGAGAAGGGAAAGGGCACTAGCCTATGCATTCACACATCAGCAACACTTGAAG
GGCAACATGAGATCTGGAAACACGATGTTCATGGATCCTAGCAACCCTACTTGGGGTTGGAGCTGGTTGGAAAGGTGGAT
GGCTGACAAGCCATGGGAAAGCTCGGAGAAAGAACAAAGCAAGAAGGAAAAGTCATCGGTTAAGACCTCGACCAGCCGTA
ACTCCCATGGAGTAGAAACAACAAAACCTTCAAACCGTAAAAAACTCACTAGCTTGACTCAACCCAATGTGCCATCATCA
TCATCATCATTATCCACCAGTAGAAACCCGAGAAAGACCAAACCAACACCATCGTCTATAAAATCCAAGACCACAGATGA
AATCACCAAGAGCTCGGACCGTAAACACAGCATCGCAAGGTCAGCGGTTAGTGATGACGAGGGCTTAGCTAGCTCAACAG
CTAGACGTCGTAACACGGTTCCCACAAAACCAACACGAGGCAAGCTCAAGGGTCAGAGCTCGTCAGGCGTCTCTGCTGCC
AACACGGCAACCACAGAGGAAAATAATGAGAAAGCACCAATAAAGAAACGGGTTTCTACTGCACCCAAACCAAGAAAATC
CTCAGCCCCGCCCAACAGCATTCTAAAGAAGGTGGGAACGCCGAGTGACTAG