Details for Chinese cabbage Locus Brara.A03515

Position : A01 ( 5`- 28616822 .. 28619831 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03515

Protein [Map View]
MEKSANFLFGGTNFNRKKFAPDFAKFKNRKEDDDDDHNKKVSFFEQEEEEEEKPEQEKTVSSSSSSKKRKRKSASSEPVE
GFDVFKSSKKSRSKGKEVEQDTKDETLENPKKEFYRQMEQDALSRKQYNIHVSGENVPAPLKSFTELLSRYGCKKYILRN
LAELGFKEPTPIQRQAIPILLSGRECFACAPTGSGKTFAFICPMLIKLKRHSSDGIRAVILSPARELAAQTAREGKKLIK
GSKFNIRLMTKPLVKTADFSKLQCDVLISTPMRLKRAIKAKKIDLSKVEYLVLDESDKLFEQSMLKQIDGVVKACSNPSI
IRSLFSATLPDSVEELARSIMHDAVRVIIGRKNTASETVKQKLVFAGTEEGKLLALRQSFAQSLNPPVLIFLQSKERAKQ
LYDELKCEDIRVGVIHSDLPPGERENAVDSFRAGETWVLIATDVIARGMDFKGINCVINYDFPDSASAYIHRIGRSGRAG
RSGEAITFYTEEDVPFLRNIANTMTSSGCEVPSWILTLKKKKWKKHRPKRDSISTRPKDSKIEQEE*

DNA
ATGGAGAAAAGCGCGAATTTTCTGTTCGGTGGAACAAACTTCAATCGGAAAAAGTTCGCTCCAGATTTCGCCAAGTTCAA
GAATCGTAAGGAGGATGATGATGATGATCACAACAAGAAAGTAAGCTTCTTTGAGCAAGAAGAAGAAGAAGAGGAAAAGC
CTGAGCAAGAGAAGACAGTTTCCTCCTCCTCCTCCTCTAAGAAGAGGAAACGAAAATCTGCTAGTTCTGAGCCTGTTGAA
GGGTTTGATGTGTTCAAGAGCTCGAAGAAGTCACGTTCTAAAGGGAAAGAGGTTGAACAAGACACAAAGGATGAGACTTT
GGAGAATCCCAAGAAGGAGTTTTATCGGCAAATGGAGCAAGATGCTTTGTCGAGGAAACAGTACAACATTCATGTCTCTG
GTGAAAATGTTCCAGCCCCACTTAAAAGCTTCACAGAGTTGTTATCAAGGTATGGTTGTAAGAAATATATATTACGCAAT
TTAGCTGAACTTGGATTCAAAGAGCCTACACCTATCCAAAGGCAGGCTATTCCAATTCTACTATCGGGTCGTGAGTGCTT
TGCCTGTGCTCCAACTGGTTCAGGAAAAACCTTTGCTTTTATTTGCCCCATGCTTATAAAACTCAAGCGTCATTCAAGTG
ATGGTATAAGAGCAGTTATCCTCTCTCCTGCAAGAGAACTAGCCGCCCAGACAGCTAGAGAAGGGAAGAAACTTATCAAA
GGAAGCAAGTTCAACATCAGGTTAATGACTAAACCCCTCGTCAAAACCGCTGATTTCTCCAAGCTGCAGTGTGATGTGCT
CATATCAACGCCGATGCGGCTTAAACGAGCCATCAAGGCTAAAAAAATCGACTTAAGCAAGGTGGAGTATCTTGTCCTTG
ATGAATCAGACAAGCTGTTTGAGCAGAGCATGTTGAAGCAAATAGACGGTGTGGTTAAGGCTTGTTCAAACCCTTCGATC
ATACGCTCACTGTTCAGTGCTACGTTGCCTGATTCTGTTGAGGAACTTGCACGTTCCATAATGCATGATGCTGTTCGTGT
CATCATTGGGCGAAAGAACACAGCATCTGAAACCGTCAAGCAAAAGCTTGTTTTTGCTGGAACTGAAGAAGGGAAGCTCC
TCGCTCTTCGCCAAAGCTTTGCACAGAGTCTGAATCCACCGGTACTAATCTTTCTGCAAAGCAAAGAACGAGCAAAACAA
CTCTACGATGAACTGAAATGTGAAGACATCAGAGTCGGTGTCATCCATTCCGATCTCCCTCCAGGAGAGAGAGAAAACGC
TGTTGATAGCTTCAGGGCAGGCGAGACGTGGGTTCTGATAGCCACTGATGTGATCGCTAGAGGTATGGATTTCAAAGGGA
TTAACTGCGTGATCAACTATGACTTCCCGGACTCTGCTTCTGCGTACATCCACAGGATTGGTCGATCAGGGAGAGCGGGA
AGGAGCGGTGAAGCGATAACGTTCTACACGGAGGAAGATGTGCCTTTCCTTAGGAACATAGCCAACACCATGACATCATC
TGGCTGTGAGGTTCCGTCGTGGATCCTGACTTTGAAGAAGAAGAAGTGGAAGAAGCATAGGCCAAAGCGTGATTCTATAT
CCACTCGACCCAAAGACAGTAAAATCGAACAAGAAGAGTAA