Details for Chinese cabbage Locus Brara.A03513

Position : A01 ( 5`- 28612886 .. 28614122 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03513

Protein [Map View]
MADEFSGKIESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPPRKKKPLSKKKMKKEKLKKGVQVPGE*

DNA
ATGGCTGATGAATTCTCTGGAAAAATAGAGAGCAAAGGGCTCAACCCGGGACTGATCGTCCTTCTTGTGATTGGAGGGTT
GCTAGTGACGTTCCTTGTAGGAAACTTCATCCTCTACACATACGCGCAGAAGAATTTGCCTCCGAGGAAGAAGAAGCCCC
TTTCCAAGAAGAAGATGAAGAAGGAGAAGCTGAAGAAGGGAGTTCAAGTTCCTGGCGAGTAG