Details for Chinese cabbage Locus Brara.A03512

Position : A01 ( 5`- 28610514 .. 28612492 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03512

Protein [Map View]
MTVIDILTRVDSICKKYDKYDVDKQREANVSGDDAFARLYGAFETQIETALEKAELVTKEKNRASAVAMNAEIRRTKARL
SEEVPKLQRLAVKRVKGLTTEELAARNDLVLALPARIEAIPDGTAGGPKSTSAWAPSTASRPDIKFDSDGRFDDDYFQES
HESSQFRQEFEMRKIKQEQGLDMISEGLDALKNMASDMNEELDRQVPLMDEIDSKVDRATSDLKNTNVRLKDTVNQLRSS
RNFCIDIVLLCIVLGIAAYLYNVLK*

DNA
ATGACGGTGATCGACATTCTGACTAGAGTTGACTCGATCTGTAAGAAGTACGACAAGTACGATGTCGACAAACAGCGTGA
GGCCAATGTCTCCGGCGATGATGCCTTTGCTCGTCTCTATGGAGCCTTTGAGACTCAAATCGAGACAGCTCTCGAGAAAG
CTGAGCTTGTTACCAAGGAGAAGAACAGAGCTTCTGCTGTTGCAATGAACGCTGAGATCCGCAGGACAAAGGCGAGATTG
TCTGAGGAAGTTCCCAAGTTGCAGAGACTTGCTGTTAAACGGGTTAAGGGCCTTACAACGGAAGAGCTTGCTGCTAGAAA
TGATTTGGTGCTTGCGCTTCCGGCCAGGATTGAAGCCATACCTGATGGAACAGCGGGTGGTCCTAAAAGCACCAGTGCTT
GGGCTCCCTCAACAGCATCTCGTCCTGATATCAAATTTGATTCAGATGGGCGTTTTGATGATGATTACTTTCAAGAATCA
CATGAATCCAGCCAATTCAGACAGGAGTTTGAGATGCGAAAAATAAAGCAGGAACAAGGTCTGGACATGATCTCGGAAGG
TTTAGATGCTTTGAAGAATATGGCGTCTGATATGAACGAGGAGCTGGATAGGCAAGTTCCTCTCATGGATGAAATCGACT
CCAAGGTGGACAGAGCAACCTCGGATCTTAAGAACACCAATGTTAGACTTAAAGATACTGTGAATCAGCTGAGGTCAAGC
CGGAACTTTTGCATCGATATTGTTTTGTTGTGTATTGTTCTTGGTATCGCTGCATACTTATACAATGTACTGAAGTAA