Details for Chinese cabbage Locus Brara.A03510

Position : A01 ( 5`- 28604814 .. 28606767 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03510

Protein [Map View]
MSGFHGTNDSCPLVKNILLLDSEGKRVAVKYYSDDWSTHAAKLSFEKLVFSKTSKTNARTEAEITLLDSNIIVYKFAQDL
HFFVTGGEDENELVLSSVLQGFFDAVALLLRNNVEKMEALENLDLIFLCLDEMVDQGVVLETDPNVIAGKVAMQSTEASG
SLSEQTLTQALATAREHLARSLLT*

DNA
ATGTCAGGCTTTCACGGGACTAATGATTCATGTCCTTTGGTGAAGAACATTCTGCTTCTAGACTCTGAAGGGAAGCGTGT
GGCTGTCAAGTATTACTCTGATGACTGGTCAACTCATGCTGCCAAGTTGAGTTTCGAGAAGCTTGTGTTCTCCAAGACAT
CTAAGACCAATGCTCGCACTGAAGCTGAAATCACACTGTTGGACAGTAATATCATTGTCTATAAGTTCGCCCAGGACCTT
CACTTCTTTGTTACTGGAGGGGAAGATGAGAACGAGCTCGTCTTGTCTTCTGTTCTTCAAGGCTTTTTCGATGCTGTTGC
ACTTCTTCTGAGGAACAATGTGGAAAAGATGGAAGCTCTTGAGAATTTGGATCTCATCTTTCTCTGCCTGGATGAAATGG
TCGATCAGGGGGTGGTACTTGAAACGGACCCTAACGTCATTGCGGGGAAAGTAGCAATGCAGAGCACAGAAGCTAGTGGT
TCACTCTCTGAACAGACATTAACTCAAGCACTGGCAACAGCTCGGGAGCATCTGGCAAGAAGTCTGCTTACGTGA