Details for Chinese cabbage Locus Brara.A03509

Position : A01 ( 5`- 28602280 .. 28604684 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03509

Protein [Map View]
MASSDFDGILLGMGNPLLDVSAVVDQEFLDKYDIKLNNAILAEDKHLPMYDEMSEKFTVEYIAGGATQNSIKVAQWMLQI
PGATSYMGSIGKDKYGEAMKKDATAAGVNIHYHEDESAGTGTCGVCVVGGERSLIANLSAANCYKVEHLKKPENWALVEK
AKFYYIAGFFLTVSPESIQLVREHAAANNKVFTMNLSAPFICEFFKDVQVKCLPYMDYVFGNETEARTFSRVHGWETDDV
EQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVILLPKEKLVDTNGAGDAFVGGFLSQLVHGKAIEECVR
AGCYASNVVIQRSGCTYPEKPDFN*

DNA
ATGGCGTCCTCTGATTTCGATGGAATCCTCCTGGGAATGGGAAACCCACTCCTCGACGTCTCAGCCGTCGTCGACCAAGA
GTTTCTCGACAAATACGACATCAAGTTGAACAATGCGATTCTCGCTGAAGACAAACATTTGCCCATGTACGATGAGATGA
GCGAGAAGTTCACTGTCGAATACATTGCTGGAGGTGCTACACAGAACTCAATCAAAGTGGCCCAGTGGATGCTTCAAATC
CCTGGGGCAACCAGTTACATGGGATCCATTGGTAAGGACAAGTATGGTGAGGCAATGAAGAAGGATGCCACTGCTGCTGG
TGTTAATATTCACTATCATGAAGATGAGTCAGCAGGTACAGGAACTTGCGGTGTCTGCGTTGTTGGTGGAGAAAGGTCTC
TTATTGCGAATCTTTCTGCTGCTAATTGCTACAAGGTTGAACACCTAAAGAAGCCTGAGAACTGGGCTCTCGTTGAGAAA
GCCAAGTTCTACTACATTGCTGGATTCTTCCTCACGGTATCACCAGAATCTATTCAGTTGGTACGTGAGCACGCCGCTGC
AAACAACAAGGTGTTCACCATGAACCTTTCTGCTCCATTCATTTGTGAATTCTTCAAAGACGTGCAAGTGAAGTGCCTGC
CGTACATGGACTACGTCTTCGGCAATGAGACGGAGGCAAGAACCTTCTCCAGGGTTCACGGATGGGAGACCGATGATGTT
GAGCAAATAGCAATCAAGATCTCTCAGTTGCCTAAAGCCACCGGAACATACAAGAGAACCACTGTGATTACACAAGGCGC
AGATCCAGTGGTTGTTGCCGAGGATGGAAAGGTGAAGAAGTACCCAGTCATCCTTCTCCCCAAGGAGAAGCTCGTTGACA
CAAACGGTGCAGGTGATGCGTTTGTGGGAGGGTTTCTTTCGCAGCTGGTGCATGGTAAGGCGATCGAGGAGTGTGTCAGG
GCGGGATGCTACGCTTCAAACGTAGTGATTCAGAGGTCTGGCTGCACTTACCCTGAGAAACCAGACTTCAACTAA