Details for Chinese cabbage Locus Brara.A03508

Position : A01 ( 5`- 28597577 .. 28600299 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03508

Protein [Map View]
MKCFKFSSGDKKEEHNKTPKSVSLTSNFSDRDINRSGSDFNSRDASGTSTESSMGRKNSYPSMSARESNLREFSVTDLKA
ATKNFSRSVMIGEGGFGCVFRGTVRDLEDPSIKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGYCAEDDER
GIQRLLVYEYMPNRSVESHLSPRSLTVLTWDLRLRIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDEDWKAKLSDFGL
ARLGPSEGLTHVTTDVVGTMGYAAPEYIKTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPNGEQKLLEWVRPYLSDTKK
FKLILDPRLEGKYNLKAVQKLSVVANRCLVRNPKARPKMSEVLEMVTKIVEAPSGSGTSPKLVPLKSLETSRDVGGKKKK
VLETRNNGGGGGEGGWFGKLWNPKAVGAC*

DNA
ATGAAGTGTTTCAAATTCTCTAGCGGTGACAAGAAAGAGGAACACAACAAGACTCCCAAGTCTGTCTCACTGACCTCCAA
CTTCTCCGACCGCGACATAAACCGAAGCGGGTCGGATTTCAACTCTAGAGACGCCTCTGGGACGAGCACGGAGTCGTCCA
TGGGGAGGAAGAACTCGTACCCTTCAATGTCTGCTAGAGAAAGTAATCTCAGAGAGTTCAGCGTTACTGATCTCAAGGCT
GCGACTAAGAACTTTAGCCGCTCTGTTATGATTGGAGAAGGAGGTTTTGGTTGTGTCTTCAGGGGAACAGTGAGGGACTT
GGAAGATCCGTCGATTAAAATCGAAGTCGCGGTTAAGCAGCTCGGTAAAAGAGGGTTGCAGGGGCATAAGGAATGGGTCA
CGGAAGTGAACTTTCTTGGTGTGGTTGAGCATTCAAACTTGGTGAAGTTGCTTGGATACTGTGCAGAAGATGATGAACGT
GGGATCCAACGGCTTTTGGTTTATGAATACATGCCAAACCGAAGCGTTGAGTCCCACTTATCCCCTCGCTCACTCACAGT
CCTTACTTGGGATCTAAGGCTGAGAATCGCTCAAGATGCAGCTCGGGGTTTAACATACCTGCATGAACAAATGGAGTTTC
AGATAATATTCAGGGACTTTAAGTCCTCGAACATTCTCTTGGATGAGGACTGGAAAGCAAAGCTCTCTGACTTTGGCCTG
GCTCGTTTAGGTCCATCTGAAGGACTAACTCATGTTACTACTGATGTTGTAGGTACAATGGGTTATGCAGCTCCTGAATA
CATTAAAACGGGTCGTCTCACATCCAAAAGCGATGTGTGGGGTTATGGAGTGTTCATCTACGAGCTTATCACAGGGAGGC
GACCAGTTGACAGGAACAAACCTAATGGAGAGCAGAAGCTTCTAGAATGGGTGAGACCTTATCTATCAGACACAAAGAAG
TTCAAGCTCATATTAGACCCAAGACTTGAAGGGAAGTACAATCTTAAAGCAGTGCAGAAGCTATCAGTTGTAGCCAACAG
ATGTTTGGTTAGGAACCCAAAAGCACGTCCCAAGATGAGTGAAGTGTTGGAGATGGTGACTAAGATTGTGGAAGCGCCTT
CAGGGAGTGGTACTAGCCCGAAGCTAGTTCCACTGAAGAGTCTAGAGACTTCTAGAGATGTGGGAGGGAAAAAGAAGAAG
GTTTTAGAGACGAGGAACAATGGTGGTGGAGGAGGTGAAGGAGGTTGGTTTGGTAAGTTATGGAACCCGAAGGCAGTAGG
AGCTTGTTGA