Details for Chinese cabbage Locus Brara.A03497

Position : A01 ( 5`- 28513298 .. 28516216 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03497

Protein [Map View]
MILQDEQALFYKKISAMSSGGTVRRVSRQDIQLVQNLIERCLQLYMNQKEVVETLLEQAKIEPGFTELVWQKLEEENREF
FKAYYLRLMVKHQIMEFNKLLEQQVHHMQQMHPSGVAPVQNTNGSHIQSMNQKHLGYASEHTDQSLKSMPLSLSNAYLNG
SSTLNTTNVASSVNISTHARRVDSSSPNMLSSQTTTNMPMMQGMNGGGGMIKSETAFTSPASFMYGGERNALEGHSTVRD
TTSISTFGNESNNNQQPLSETLLDSEAATFGFLGQIPRNFSLSDLTADFSQSSEILESYDKSPFLVPDGENFLDSCDRGE
YQGDNKRLETISEGFSYDNIGSE*

DNA
ATGATATTGCAAGATGAACAAGCTCTGTTTTACAAAAAAATCTCAGCCATGTCAAGTGGAGGAACAGTGAGAAGGGTCTC
ACGTCAAGATATACAACTGGTTCAAAACCTTATAGAAAGATGCCTTCAACTCTACATGAACCAGAAAGAAGTCGTGGAAA
CTTTATTGGAGCAGGCTAAAATCGAGCCTGGCTTCACAGAACTAGTTTGGCAGAAGCTTGAAGAAGAGAATCGTGAGTTT
TTCAAGGCTTACTATCTTAGGCTCATGGTAAAACACCAGATAATGGAATTCAACAAGCTACTTGAGCAGCAGGTTCACCA
CATGCAGCAGATGCATCCAAGTGGAGTTGCTCCCGTCCAAAACACAAACGGTTCTCATATTCAATCAATGAATCAGAAGC
ATTTGGGTTATGCCTCTGAGCACACTGATCAATCTTTGAAGTCGATGCCCTTGAGTCTCTCTAATGCATACCTCAATGGC
TCTTCAACACTCAATACAACAAACGTAGCCTCTTCTGTGAACATATCAACTCATGCAAGGAGAGTTGATTCTTCTTCTCC
AAACATGCTCTCATCACAGACTACTACAAACATGCCAATGATGCAAGGAATGAATGGAGGAGGAGGGATGATCAAGTCTG
AAACCGCCTTTACAAGCCCTGCTTCTTTCATGTATGGTGGTGAAAGGAACGCCTTGGAAGGGCATTCCACTGTTAGAGAC
ACTACTTCGATCTCAACCTTTGGTAACGAGTCCAACAACAACCAACAACCTCTCAGTGAGACGCTTCTTGATTCAGAAGC
TGCTACTTTTGGGTTCTTAGGTCAGATCCCTAGGAACTTCAGCCTCTCTGATTTGACTGCTGATTTTTCTCAGAGCTCAG
AGATTCTAGAGAGCTATGATAAGTCACCTTTCCTTGTGCCGGATGGTGAAAACTTCCTGGACTCATGCGACAGGGGAGAG
TATCAAGGAGACAACAAGAGATTGGAGACCATATCTGAAGGTTTCAGTTATGATAACATTGGGAGCGAGTAG