Details for Chinese cabbage Locus Brara.A03496

Position : A01 ( 5`- 28510208 .. 28511288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03496

Protein [Map View]
MHEKNIVEDVINDFVDNFTETVQKKKNVSFFEQEETVSSRFNRMFGREKPIHHVLGGGKSADVLLWRNKKISASVLMGAT
AIWVLFEWINFHFLSLVCYGLLLGMIVQFVWSNASGALNRSQSGVPRLVLPKDFFADVGVTVGTEVNRGLMFLQDLACRG
SLKQFLMVLYILLTYLHNV*

DNA
ATGCATGAGAAGAATATTGTAGAGGACGTTATCAACGACTTCGTTGATAACTTCACTGAGACAGTTCAGAAGAAAAAAAA
CGTTTCTTTCTTCGAACAAGAAGAAACCGTCTCTTCTCGTTTCAACCGCATGTTCGGTCGGGAGAAGCCGATCCATCATG
TCTTAGGCGGTGGCAAATCTGCTGATGTGTTGTTGTGGAGGAACAAGAAGATCTCCGCAAGTGTTCTGATGGGAGCTACT
GCAATCTGGGTGCTTTTCGAGTGGATCAACTTCCATTTTCTCTCTCTCGTTTGTTACGGTCTCTTGCTTGGTATGATCGT
GCAATTCGTCTGGTCTAATGCCTCAGGGGCTCTAAACCGCTCACAGTCTGGAGTGCCTCGCCTTGTTCTTCCAAAAGACT
TCTTTGCTGATGTTGGTGTGACCGTTGGAACAGAGGTTAACCGTGGTTTGATGTTTCTTCAGGACTTGGCTTGTAGAGGG
AGTTTGAAACAGTTCCTCATGGTATTGTATATCTTATTAACATATCTGCATAATGTATAA