Details for Chinese cabbage Locus Brara.A03495

Position : A01 ( 5`- 28507663 .. 28509469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03495

Protein [Map View]
MNNKKNPDQKPEMPPSSSSPKKQTLFISSLILLWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYLSIVFLK
LVPLQHLKSRSQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYGALVPVVTGV
VIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSEGEKLNSMNLMLYMSPIAVIALLPVTIVMEPDVMSVTLSLAR
QHQYMWILLLVNSVMAYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILLFRNPVTVMGIGGYSITVLGVVAYGETK
RRFR*

DNA
ATGAACAACAAGAAGAACCCAGATCAGAAACCAGAGATGCCACCCTCCTCATCCTCCCCGAAGAAACAAACCCTCTTCAT
CTCCTCCCTCATCCTCCTCTGGTACACCTCCAACATCGGCGTCCTCCTCCTCAACAAGTTCCTCCTCTCCAACTACGGTT
TCAAATTCCCCATCTTCCTCACCATGTGCCACATGTCCGCCTGCGCCATCCTCAGCTACCTCTCCATCGTCTTCCTCAAG
CTCGTCCCCCTCCAGCACCTCAAATCTCGCTCCCAGTTCATGAAGGTCGCGACCCTCAGCATTGTCTTCTGCGCCTCCGT
CGTCGGTGGGAATGTCTCGCTGCGTTATCTTCCCGTTTCGTTTAATCAGGCTGTTGGCGCTACGACGCCGTTTTTCACGG
CGTTGTTTGCGTATCTTATGACGTTTAAGAGAGAGGCTTGGGTTACGTATGGTGCGCTTGTCCCTGTTGTTACCGGTGTT
GTGATCGCTAGTGGGGGTGAGCCAGGTTTCCACTGGTTTGGGTTCATTATGTGCATTAGTGCAACCGCAGCAAGAGCTTT
TAAATCTGTGCTTCAAGGCATCTTGCTTTCTTCTGAAGGAGAAAAGTTGAATTCGATGAACTTGATGTTGTACATGTCCC
CTATAGCCGTCATTGCGCTTCTGCCAGTTACAATAGTAATGGAACCAGATGTGATGAGTGTGACTCTATCGCTCGCAAGA
CAGCATCAGTACATGTGGATACTTCTTTTGGTTAACTCTGTAATGGCTTATTCAGCTAACTTGTTGAACTTTCTTGTTAC
CAAACACACAAGCGCTCTTACCCTCCAGGTTCTTGGAAACGCTAAAGGAGCGGTTGCGGTTGTGATCTCGATCTTGCTTT
TCCGAAACCCGGTCACGGTGATGGGGATTGGCGGGTACAGTATAACAGTGCTTGGGGTTGTTGCGTATGGAGAGACTAAA
CGCAGGTTTAGATGA