Details for Chinese cabbage Locus Brara.A03493

Position : A01 ( 5`- 28495413 .. 28497801 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03493

Protein [Map View]
MATLSSSLLSSSPLCKSRFSPSRTDFIYFSPRRTLSVASPAILSLSVKHRRYRNSFQVRSVASPAETASEFDEMVSGTKR
KYYMLGGKGGVGKTSCAASLAVRFANNGHPTLVVSTDPAHSLSDSFAQDLTGGMLVPVEGPEAPLFALEINPEKAREEFR
SASQANGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESPEYNMFTRIVFDTAPTGHTLRL
LSLPDFLDASIGKILKLRQKITSATSAIKSVFGKEDNKPDAADKLERLRERMVKVRELFRDTESTEFVIVTIPTVMAVSE
SSRLSASLKKESVPVKRLVVNQILPPSSSDCKFCSIKRKDQMRALDMIREDSELSGLTLMQAPLVDMEIRGVPALRFLGD
IIWK*

DNA
ATGGCGACTCTTTCATCCTCTCTATTATCTTCTTCTCCTCTATGCAAATCAAGATTCTCTCCGTCGAGAACTGACTTCAT
CTATTTCTCCCCTCGAAGAACTCTCTCCGTCGCCTCGCCGGCGATTCTCTCTCTCTCCGTCAAACATCGTCGCTACAGAA
ACTCTTTCCAAGTGAGATCAGTAGCTAGTCCCGCGGAGACGGCGTCGGAGTTCGATGAGATGGTCTCGGGGACGAAGAGA
AAGTATTACATGCTCGGAGGGAAAGGAGGAGTGGGGAAAACTAGCTGCGCAGCTTCTTTGGCTGTGAGGTTTGCTAACAA
TGGTCACCCAACTCTTGTTGTCTCCACTGATCCAGCTCATTCCTTGAGTGACTCCTTTGCTCAGGACTTGACTGGAGGAA
TGCTTGTGCCTGTTGAAGGACCTGAAGCTCCTTTGTTTGCTCTTGAAATAAACCCTGAGAAGGCTAGAGAAGAGTTTCGC
AGTGCCTCTCAGGCGAATGGAGGGACTGGGGTTAAAGATTTTATGGATGGTATGGGACTTGGCATGCTTGTTGAACAGTT
GGGGGAACTAAAACTTGGTGAGTTGCTTGACACACCACCTCCTGGATTGGATGAAGCCATTGCCATTTCTAAGGTCATTC
AATTTTTGGAATCACCTGAATATAACATGTTCACCAGGATCGTGTTTGACACTGCACCAACGGGTCACACGCTAAGGCTA
CTCTCCTTACCAGACTTCCTTGACGCGTCCATAGGTAAAATCTTGAAGCTTAGGCAGAAAATAACCTCAGCTACTTCAGC
GATCAAATCAGTATTTGGGAAAGAAGATAACAAGCCTGATGCTGCTGACAAATTGGAACGGCTAAGAGAGAGGATGGTTA
AAGTTAGAGAGCTTTTTCGTGACACAGAGTCAACAGAGTTCGTCATTGTCACCATCCCCACGGTAATGGCTGTCAGCGAG
TCTTCTAGATTAAGTGCTTCATTGAAGAAAGAAAGTGTCCCCGTCAAAAGACTTGTTGTTAATCAGATTCTCCCTCCATC
CTCCTCTGACTGCAAATTTTGTTCCATAAAAAGAAAGGACCAAATGCGAGCTCTTGATATGATCAGGGAGGATTCAGAAC
TCTCAGGCTTGACATTAATGCAGGCTCCGCTTGTAGACATGGAGATCAGAGGCGTTCCTGCTCTGCGCTTCTTGGGAGAT
ATCATTTGGAAATGA