Details for Chinese cabbage Locus Brara.A03491

Position : A01 ( 5`- 28488921 .. 28492572 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03491

Protein [Map View]
MSVSSLRRLAVSAAVIAAASGGAVYLSPSVASSDRAGGGPVLDSLKRTLGDPSASVPSRSAQESALIKATSSNPLDVLVI
GGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLC
HALPCMTPCFDWFEVVYYWMGLKMYDLVAGPRLLHLSRYYSAQESAELFPTLARKGKDKSLRGTVVYYDGQMNDSRLNVG
LACTAALAGAAVLNHAEVVSLITDDVTKRIVGARVRNNLTGKEFESYARVVVNAAGPFCDSIRKMVDEDTKPMICPSSGV
HIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNTSITPLPEPHEDEIQFILDAISDYLNIKVRRTDVLSA
WSGIRPLAMDPTAKSTESISRDHVVFEEHPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPTNGCVTQKLQLLGSHGWE
PSSFTALAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMAERVATIAQEEGLGKRLAHGHPFLEAEVAYCARHEYCE
SAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKSREKQELQKAKEFLQTFKSSKNAQFHDGKHN*

DNA
ATGTCAGTCTCTTCCCTCCGCCGTCTAGCCGTCTCCGCCGCCGTAATCGCCGCTGCATCCGGCGGCGCCGTCTACCTCTC
CCCCTCCGTTGCCTCCAGCGACAGAGCCGGCGGCGGTCCGGTTCTAGATTCGTTGAAACGTACTCTCGGCGATCCCTCAG
CCTCCGTACCGTCTCGATCCGCTCAAGAGTCTGCTCTCATCAAAGCCACCTCTTCTAATCCGCTCGACGTCCTCGTGATT
GGCGGTGGAGCCACCGGCTCTGGAGTGGCTCTCGACGCTGCGACACGTGGACTCCGCGTAGGTCTCGTGGAGCGCGAGGA
TTTCTCCTCGGGGACATCTTCACGTTCAACAAAGCTAATCCATGGAGGAGTTCGTTACTTGGAGAAAGCTGTGTTCAATC
TCGACTACGGACAGCTAAAGCTTGTCTTCCACGCGCTCGAGGAGCGTAAACAGCTCATCGAGAACGCGCCCCATCTCTGC
CACGCGCTCCCCTGTATGACACCTTGTTTCGACTGGTTCGAAGTTGTCTACTACTGGATGGGGCTGAAGATGTACGACTT
GGTGGCGGGACCGCGGTTGTTGCATCTGTCTAGGTACTACTCTGCGCAAGAGTCTGCTGAGCTCTTCCCTACTCTCGCGA
GGAAAGGGAAGGACAAGAGCTTGAGGGGGACTGTTGTGTATTACGACGGGCAGATGAATGATTCGCGTTTGAATGTTGGG
TTGGCGTGTACTGCTGCTTTAGCTGGTGCTGCGGTTCTCAACCATGCTGAGGTTGTGTCGCTTATTACGGATGATGTTAC
CAAGAGAATAGTTGGTGCCAGGGTTCGTAACAATCTCACAGGCAAAGAGTTTGAGAGCTATGCGAGAGTAGTAGTTAATG
CGGCTGGACCGTTCTGTGATTCCATAAGGAAGATGGTTGATGAAGATACAAAGCCTATGATATGTCCAAGCAGCGGTGTA
CACATTGTGCTGCCTGATTACTATTCACCAGAAGGGATGGGTTTGATAGTTCCTAAAACTAAGGATGGTCGCGTTGTGTT
CATGTTACCGTGGTTGGGAAGAACGGTAGCTGGGACTACAGACTCTAACACGTCAATAACTCCGCTTCCTGAACCTCATG
AGGATGAGATTCAGTTTATATTGGATGCAATAAGTGACTATCTTAACATTAAGGTTCGACGTACTGATGTTCTCTCGGCT
TGGAGTGGTATACGTCCGTTGGCTATGGATCCAACTGCAAAGAGCACAGAGAGTATCTCAAGAGACCACGTTGTCTTCGA
GGAACATCCTGGTCTGGTCACTATCACTGGTGGAAAATGGACAACTTATCGAAGTATGGCTGAAGATGCGGTTAATGCAG
CAATCAAATCAGGGAAGCTGAGTCCAACCAATGGATGCGTAACACAGAAGCTACAGCTTCTTGGTTCTCATGGATGGGAA
CCATCTTCTTTCACAGCTCTTGCGCAGCAATACGTGCGCATGAAGAAAACATATGGTGGTAAAGTGGTTCCTGGAGCAAT
GGACACAGCTGCTGCAAAGCATTTGTCTCATGCATACGGTTCGATGGCTGAACGAGTCGCCACCATAGCTCAGGAGGAGG
GTTTGGGGAAACGGTTGGCGCATGGACATCCGTTTCTTGAAGCAGAGGTTGCGTACTGTGCAAGGCACGAGTACTGCGAG
TCAGCGGTTGATTTTATAGCGAGGAGATGTAGAATAGCGTTCTTGGACACAGACGCGGCGGCGAGGGCGTTGCAGCGTGT
GGTGGAGATTCTAGCGAGTGAACACAAGTGGGACAAGTCGAGGGAGAAGCAGGAGTTGCAGAAGGCTAAAGAGTTTCTTC
AGACATTCAAGTCTTCCAAAAACGCACAGTTTCACGATGGCAAACACAACTGA