Details for Chinese cabbage Locus Brara.A03490

Position : A01 ( 5`- 28480172 .. 28488841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03490

Protein [Map View]
MGIFDGLPVPSDKTYLRDELARIDESWAVARFDSLPHVVHILTSKDRETDVLLLKEQSDVVEEVVDEVVHAYHGGFNKAI
QNYSQILRLFSESTEKLGDLKHDLADAKRSLGTRNKQLHQLWYRSVTLRHIIALLDQIEGIAKVPSRIEKLIADKQFYAA
IQVYLQSSLMLEREGLQTVGALQDVRSELTKLRGALFFKILDDLHAHLYNRGEYSSVASSIYERDDDVPTTTAVAASRMS
SQPLSRRTRTLKGDSQFVVRGLTNGSHRTSSIEEGSSFDGHDEEDSVEHDEATDSKLLSHQLTPWLSDSTPDEFIEAVRK
SDDPLHVKYLQTLVQCLCMLGKVAAAGAIICQKLRPTIHEIIISKIKAHMETRNLSKSACSQGDQTVAAGLHFIKGQPEA
YRLSKEKPQNRISNSGTHLAVSPVSPLMVPGGKAQAAAKDLLDSILDTINFVKDHLLPTMFVDYRKGVQQAISSAAAFRP
RAHTTTYTPTVEKGRPILQGLLAIDLLAKEVLGWAQAMPKFSTDLVKYVQTFLERTFERCRTSYMEAVLEKLSYRLIGRH
DIEKLMRLDPASACLPALLGHSVSHSEAVGSDVELCELFLSLPSIKQDSLIRDDNKLILLASLSDSLEYVADSIERLGQA
VPRAASQSEDNSRNQATSPRNLASFADEYRKLATDCLKVLRVEMQLETVFHLQEMTNREYLEDEDAEEPDDFVISLTSQI
TRRDEGMAPFISGEKRNYVFGGICGIAATASIKALAEMRSINLFGVQQICRNTIALEQAMAAIPYVDGESVQQNLDRVRT
YFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRDTPTDAQSLLSEILSH*

DNA
ATGGGGATCTTCGACGGTTTGCCTGTTCCCTCAGATAAAACTTACCTTAGGGATGAGCTGGCACGAATAGATGAGAGCTG
GGCTGTTGCACGGTTCGACTCTTTGCCACATGTGGTCCATATCCTCACCTCAAAAGACCGTGAGACTGACGTTCTTTTAC
TAAAGGAACAAAGTGATGTTGTCGAGGAGGTTGTGGATGAAGTTGTGCATGCTTATCACGGTGGTTTCAACAAGGCCATT
CAAAACTACTCACAGATCTTGCGATTGTTCAGTGAGTCCACTGAAAAATTAGGCGACTTGAAGCATGATTTGGCAGACGC
AAAGAGGAGCTTGGGTACACGCAATAAACAGTTGCACCAGCTGTGGTACCGTTCTGTAACATTGCGGCACATCATCGCAC
TTTTGGATCAAATTGAGGGCATTGCTAAGGTTCCATCTCGTATTGAGAAGCTCATTGCTGATAAGCAGTTTTACGCTGCT
ATTCAAGTGTATCTTCAGTCGTCTCTGATGCTTGAGCGTGAGGGGCTTCAAACGGTTGGTGCTCTTCAAGATGTCAGATC
TGAGCTAACTAAGCTGCGCGGAGCCCTTTTCTTTAAAATTCTAGACGATTTGCATGCACATCTATACAACAGAGGTGAAT
ACAGTTCAGTTGCGTCAAGCATATACGAAAGAGATGATGATGTACCAACAACAACAGCTGTTGCAGCTAGTCGAATGAGC
TCACAACCACTGTCTCGTAGAACACGGACACTGAAAGGTGATAGTCAGTTTGTTGTTAGAGGGCTCACAAATGGTTCACA
TAGAACGTCGTCTATTGAGGAAGGTTCATCATTTGATGGACATGATGAGGAGGACTCTGTCGAACATGATGAAGCTACTG
ATAGTAAACTGCTTTCTCACCAACTTACGCCATGGCTTTCTGATTCCACGCCTGACGAGTTTATTGAAGCAGTAAGAAAG
AGTGATGATCCACTTCATGTGAAGTATCTACAGACCCTTGTTCAGTGTCTCTGCATGCTTGGAAAAGTTGCAGCTGCTGG
TGCTATCATATGCCAAAAACTTCGACCCACAATACATGAGATCATTATATCCAAGATTAAAGCCCATATGGAGACTAGAA
ATTTGTCAAAGTCCGCCTGTAGTCAGGGTGATCAAACGGTAGCTGCGGGATTGCATTTTATAAAAGGACAACCAGAGGCC
TACAGACTATCAAAAGAGAAACCTCAAAACAGGATATCAAATTCAGGAACTCACCTGGCTGTGAGCCCTGTTTCGCCTCT
TATGGTTCCTGGAGGGAAGGCGCAAGCTGCTGCAAAAGACCTTCTTGACTCAATTTTAGATACTATTAACTTTGTGAAGG
ACCACCTGTTACCTACAATGTTTGTGGACTATAGGAAAGGCGTACAGCAAGCTATATCAAGTGCCGCCGCATTTAGACCA
CGTGCACATACAACTACTTACACTCCAACCGTAGAAAAGGGTCGTCCTATCTTACAAGGACTTTTGGCAATAGATCTCCT
TGCAAAAGAGGTTCTTGGTTGGGCTCAAGCCATGCCTAAATTTTCTACTGACCTTGTGAAGTATGTTCAGACATTTCTTG
AGAGAACATTTGAGAGATGTCGAACATCATACATGGAGGCTGTGCTTGAGAAGCTCAGTTACAGGCTTATTGGGAGGCAT
GATATTGAGAAATTGATGCGACTTGATCCGGCGAGTGCTTGTTTGCCAGCTCTACTTGGCCATTCTGTTTCTCACTCTGA
GGCTGTTGGCTCCGACGTAGAACTCTGTGAACTATTCTTAAGTTTGCCGTCTATCAAGCAGGATAGTCTAATTCGTGACG
ACAACAAACTGATTTTGTTAGCCTCTCTTAGCGACTCTCTTGAATACGTAGCAGACTCTATTGAGAGGCTTGGACAAGCA
GTTCCTCGTGCAGCAAGTCAATCTGAAGATAATAGCAGGAATCAAGCAACTTCTCCTAGGAACCTGGCATCATTTGCTGA
TGAGTACAGAAAACTTGCGACTGATTGCCTAAAGGTTCTACGTGTTGAGATGCAATTGGAAACAGTCTTTCATCTTCAGG
AAATGACGAATCGAGAATACTTGGAGGATGAGGATGCTGAAGAACCCGACGACTTTGTGATTTCTCTTACTTCACAGATA
ACACGTAGGGACGAGGGAATGGCGCCTTTCATCTCTGGTGAGAAGCGCAACTATGTTTTTGGTGGCATTTGTGGAATTGC
AGCGACTGCGTCCATTAAGGCTTTGGCTGAAATGAGATCGATAAACCTTTTTGGAGTTCAACAAATTTGTCGGAACACTA
TTGCATTGGAACAGGCCATGGCAGCTATTCCATATGTTGATGGTGAAAGCGTACAACAGAACCTAGATCGTGTCCGTACT
TACTTTGAACTACTAAATATGCCATTTGAGGCGTTACTTGCATTCATAGCGGAACATGACCAAATGTTTACACCCACAGA
GTATTCTAATCTTCTGAAGGTGAATGTTCCTGGAAGAGATACTCCTACAGATGCTCAATCTCTCCTTTCGGAAATTCTTT
CTCACTAA