Details for Chinese cabbage Locus Brara.A03486

Position : A01 ( 5`- 28468730 .. 28469908 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03486

Protein [Map View]
MASSKRSWTLSSLPLEVIEEILYRAPPESLLRSKPTCKQWHALITSRRFIYEHLRRSPQRFIRTNETVVHIMDPVTGRRS
DSPLPKELYDVRVMVHCDGLMLCMRGNSQYRNTKLALWNPVLRKLAWIKPSTCFTTSDYYGMGYDGKKSRYDYKILRFTD
RRYDDMHNSNNDDYYEDEAEVEIYECKTRSWRTLDAKVDWDVDITCKGVSVMGNMYWFAQKYWDAEKKHRNYILRFDFSA
ETFKDVCFAPPSRGDNYLACFYGDRLSLLQQDQETTSPIEVWVSSKLAGDGDVLFSKYFSVSRPNLPALLFHTDMAHPVY
CIGKHKRVMAWCEGNVYDGDDKIPPTCVIFYEIDEGGVRRQLETERHYYGSGYSRTFLCGYVYVPSLVPLPV*

DNA
ATGGCGTCTTCGAAGCGTTCGTGGACGTTGTCTTCGTTGCCACTGGAGGTAATAGAAGAAATACTCTACAGGGCTCCGCC
TGAATCTCTACTCCGGTCAAAACCGACGTGCAAGCAATGGCACGCTCTCATCACCAGCAGAAGATTCATCTACGAACACT
TGCGTCGCTCCCCGCAAAGATTCATAAGAACCAATGAGACAGTAGTACATATCATGGATCCGGTGACAGGAAGACGCTCA
GATTCACCACTCCCAAAAGAGCTGTACGATGTAAGAGTGATGGTACACTGCGACGGACTCATGCTGTGCATGCGTGGTAA
CAGCCAATATAGAAACACCAAACTCGCGCTTTGGAATCCCGTTTTGAGGAAACTCGCCTGGATCAAACCATCGACATGTT
TCACAACTTCTGATTACTACGGGATGGGATACGACGGCAAGAAGTCTCGATATGACTACAAGATCTTGAGGTTTACCGAT
CGTCGCTATGATGATATGCATAATAGTAATAATGATGATTATTATGAAGATGAAGCAGAGGTTGAGATATATGAGTGCAA
GACTCGTTCATGGAGAACTCTTGACGCCAAGGTTGATTGGGATGTAGATATCACGTGCAAAGGCGTGTCCGTCATGGGGA
ACATGTACTGGTTTGCTCAGAAGTATTGGGATGCTGAGAAGAAGCATAGAAACTACATTCTACGTTTCGATTTCTCAGCT
GAAACGTTCAAGGACGTATGCTTTGCTCCTCCCTCTCGTGGCGATAATTATCTAGCCTGTTTCTATGGAGATAGATTGTC
TTTGCTACAGCAAGACCAAGAAACGACAAGCCCGATTGAGGTGTGGGTTTCAAGCAAGTTGGCTGGTGATGGGGATGTCT
TGTTCAGCAAGTATTTCAGCGTGTCCCGCCCCAATCTTCCGGCGTTGCTGTTCCATACAGATATGGCTCATCCGGTGTAC
TGTATTGGGAAGCACAAACGTGTTATGGCGTGGTGCGAGGGAAATGTGTATGATGGTGATGATAAGATTCCTCCTACTTG
CGTCATTTTTTATGAAATTGATGAGGGTGGGGTAAGAAGACAGCTTGAGACAGAACGACACTACTACGGGTCTGGCTATT
CTAGGACTTTTCTTTGTGGCTACGTATACGTTCCAAGTCTAGTCCCTCTTCCGGTATAA