Details for Chinese cabbage Locus Brara.A03485

Position : A01 ( 5`- 28465328 .. 28468056 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03485

Protein [Map View]
MVRTRTTVLKVADHSVEGVSTNKAKGEKMIQDPRINSAQRRTLGDITNLPNQKVMLMNHGANQQQQSLSLSSKEYAEKLQ
KENMRLMKALTERNAIIERTGSELQRYRINLQMVQAQNLQLSQTNTRILAEIRTSKDQLKALQHELSCKNGVLMARKLPL
EPQKLPCTHHDASEDKDRANASRGASGVFHPNGEDHKTASESYDCNSLQINDKANNKRVFERSSPAKSEVLDIIGRPGES
AQTTNMTRRVSLRRQSRRFNIQELGATENLNGIHDDQESAANSGCSASDLFIGSKPETVELHDTKERTRESRRVSSRRQS
TEVTSQRDIKVSTDPPLPDGIVEESSQVSSSVSTELKRESKNKPTGDEAEEMRETYAGRPSRQATGKIKSYKEVSLKDKM
RRDF*

DNA
ATGGTGCGGACGAGAACGACGGTGCTTAAAGTCGCCGATCACTCCGTTGAAGGTGTTTCCACTAACAAAGCAAAAGGAGA
GAAGATGATTCAGGATCCTCGGATAAACAGTGCACAGAGAAGAACACTGGGAGATATCACAAACTTGCCGAATCAGAAAG
TGATGCTAATGAACCATGGAGCGAATCAGCAGCAGCAATCTTTGTCACTCTCTTCCAAAGAATACGCTGAAAAGCTTCAA
AAGGAAAACATGAGACTGATGAAAGCCCTCACGGAGAGAAATGCAATCATTGAGAGGACGGGAAGTGAGCTGCAGAGATA
TAGGATCAACTTACAGATGGTGCAAGCACAGAACTTGCAGCTTTCCCAGACCAACACTCGTATCTTGGCGGAGATCAGAA
CAAGCAAAGACCAACTGAAGGCACTTCAGCACGAACTTAGTTGCAAGAACGGGGTACTCATGGCTAGGAAACTGCCGCTT
GAGCCACAAAAGCTTCCATGTACACACCATGACGCATCAGAAGACAAGGATCGTGCAAACGCTTCTCGTGGGGCTTCCGG
AGTCTTTCATCCAAATGGCGAGGATCATAAGACTGCTTCAGAGAGTTATGACTGTAACTCATTGCAAATAAATGACAAAG
CCAACAACAAAAGAGTTTTTGAAAGGTCGAGTCCCGCCAAATCCGAAGTATTAGATATAATTGGCAGACCAGGAGAGTCA
GCACAGACAACCAATATGACCAGGAGGGTTTCTTTGAGAAGACAGTCTAGGAGATTTAATATCCAAGAGCTAGGCGCGAC
TGAAAACTTGAATGGTATACATGATGATCAAGAATCTGCTGCAAATTCCGGATGCTCTGCGAGTGATCTGTTCATCGGGT
CTAAGCCCGAAACAGTAGAGCTACATGACACGAAAGAGAGAACCAGGGAAAGCAGAAGAGTCTCTTCAAGAAGACAATCG
ACAGAAGTTACATCTCAGAGAGACATCAAAGTATCCACAGATCCTCCGTTGCCCGATGGTATTGTCGAGGAGTCTAGTCA
GGTATCATCTTCAGTTTCAACAGAGCTTAAAAGAGAATCAAAGAACAAACCAACAGGCGATGAAGCAGAGGAGATGAGAG
AAACATATGCTGGGAGACCTTCAAGGCAAGCAACAGGAAAAATCAAATCATACAAAGAAGTCTCACTTAAGGATAAGATG
CGAAGGGACTTCTGA