Details for Chinese cabbage Locus Brara.A03483

Position : A01 ( 5`- 28463116 .. 28463514 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03483

Protein [Map View]
MFRLTVVILILLSVCTEQAIGGSFFIYNQVRHGSLMKVHCKSKDNDMGWHVRKYGGVYGFDFNDNLFGTTLFWCNIWQGP
HLEHFQVIVAFESRQYPHDLNAWIRWSVRGDGIYQSINGATWKFKYHWDNKL*

DNA
ATGTTTCGTCTTACAGTAGTAATCCTTATCCTTTTAAGTGTGTGCACCGAACAAGCGATAGGAGGGTCGTTCTTTATCTA
TAACCAGGTGCGCCATGGATCCCTAATGAAAGTCCATTGCAAATCCAAAGACAACGATATGGGGTGGCACGTGAGGAAAT
ACGGAGGAGTGTACGGTTTTGATTTTAACGATAATTTATTTGGTACAACACTATTTTGGTGTAACATATGGCAAGGTCCT
CATCTGGAGCATTTTCAGGTGATAGTCGCGTTCGAAAGTAGGCAGTATCCACATGACTTAAACGCTTGGATAAGATGGTC
TGTGAGGGGAGATGGTATTTATCAATCTATCAATGGTGCAACTTGGAAATTCAAGTATCATTGGGATAACAAACTTTAA