Details for Chinese cabbage Locus Brara.A03477

Position : A01 ( 5`- 28436050 .. 28439248 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03477

Protein [Map View]
MGEIVFTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKDMFSFLRDTDEVPHNNPKLKAHAVKVFKMTCETAIQ
LREKGKVVVADTTLQYLGSVHLKSGVLDPHFEVVKEALVRTLKEGLGEKYNEEVEGAWSQAYDHLALAIKAEMKQEDSQK
P*

DNA
ATGGGAGAGATTGTGTTTACGGAGAAGCAAGAAGCTTTGGTGAAGGAGTCTTGGGAGATACTAAAGCAAGACATCCCCAA
ATACAGTCTTCACTTCTTCTCACAGATACTGGAGATAGCACCAGCAGCAAAGGACATGTTCTCTTTCCTAAGAGACACAG
ATGAAGTCCCTCATAACAATCCTAAACTCAAAGCTCATGCTGTTAAAGTCTTCAAGATGACATGTGAGACAGCAATACAG
CTGAGGGAGAAAGGAAAGGTAGTGGTGGCTGACACAACCCTCCAATACTTGGGCTCTGTTCATCTTAAGAGCGGTGTTCT
TGATCCTCACTTTGAGGTGGTGAAAGAGGCATTGGTGAGGACACTGAAAGAAGGGTTGGGGGAGAAGTACAATGAAGAAG
TGGAAGGAGCTTGGTCTCAAGCTTATGATCACTTGGCTTTAGCCATTAAGGCCGAGATGAAACAAGAAGACTCACAAAAA
CCCTAA