Details for Chinese cabbage Locus Brara.A03475

Position : A01 ( 5`- 28421970 .. 28424679 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03475

Protein [Map View]
MEVALEDNNLMEKVLPPDEQEIDVELEAKEKKYLRGEGANLESLKDKKLKTQLASREKLYGKSAKAAAKIEKWLLPASAG
YLETEGLEKTWRIKQTDIAKEVDLLSSKNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALVDMMNMNLIKEIHVRET
VRDVAFLHNDQFFAAAQKKYSYIYARDGTELHCLKERGPVARLRFLKNHFLLASINKIGQLHYQDVTYGDMVASIRTGKG
RTDVMEVNPHNGVVALGHSGGTVTMWKPTSQAPLVQMQCHPGPVSAVAFHPNGHLMATSGKERKVKIWDLRKFEEVQTIH
GFHAKTLSFSQKGLLAAGTGSFVQVLGDSSGGGGYSRYMSHSMVKGYQVEKVMFRPYEDVLGIGHSMGWSSVLIPGSGEP
NFDSWVANPFETSKQRREKEVHLLLDKLPPETIMLDPSKIGAMRPSRRKERPTRGEIEAEKEVAIEAAKSVEMKTKTKGR
NKPSKRTKKKKEMVENAKKTFPELEHSNIAGKKRRIGEDAAAELPASLKRFARKN*

DNA
ATGGAAGTCGCTTTAGAGGATAACAATCTCATGGAGAAGGTCTTACCTCCTGATGAGCAGGAGATCGATGTTGAGTTGGA
GGCTAAAGAAAAGAAGTATCTTAGAGGAGAAGGTGCTAACTTAGAGTCATTGAAAGATAAGAAACTAAAGACTCAGCTTG
CTTCACGAGAGAAGCTGTATGGCAAATCTGCAAAAGCTGCTGCTAAAATTGAGAAATGGCTCTTGCCAGCTTCGGCAGGG
TACTTGGAGACTGAGGGTTTAGAGAAGACTTGGAGGATCAAGCAGACGGATATTGCCAAAGAAGTAGATTTATTAAGCTC
AAAAAACCAATATGACATAGTCCTCCCAGATTTTGGCCCTTACAAACTTGATTTTACTGCAAGTGGACGGCATATGCTAG
CTGGTGGTCGCAAAGGACACCTTGCTCTTGTAGACATGATGAATATGAACTTGATCAAAGAGATACATGTAAGAGAAACA
GTTCGTGATGTTGCATTCCTGCACAATGACCAATTCTTTGCAGCTGCCCAGAAGAAGTATTCTTATATTTACGCGAGAGA
TGGAACTGAGCTCCATTGTCTTAAGGAGCGTGGTCCAGTAGCCAGACTCCGTTTCCTAAAGAACCATTTCCTCCTCGCAT
CAATAAACAAAATCGGTCAGCTACACTACCAAGACGTTACCTACGGAGACATGGTGGCTAGCATCAGAACAGGCAAAGGC
AGAACAGACGTAATGGAAGTGAATCCTCACAACGGCGTTGTCGCCTTGGGACATTCCGGTGGAACCGTCACGATGTGGAA
ACCCACCAGCCAAGCACCTCTGGTCCAAATGCAGTGCCACCCTGGACCGGTCTCTGCTGTTGCCTTTCATCCGAACGGTC
ATCTCATGGCCACGTCTGGTAAAGAGCGCAAAGTCAAGATCTGGGACCTCCGCAAGTTCGAGGAGGTTCAGACCATCCAC
GGTTTCCACGCCAAGACGCTGAGTTTCAGCCAGAAAGGGTTGCTAGCGGCTGGAACCGGATCGTTTGTTCAGGTTTTGGG
AGACTCGAGTGGTGGTGGTGGCTATAGTAGATACATGAGCCACTCGATGGTGAAAGGCTACCAGGTGGAGAAGGTTATGT
TCAGACCGTACGAGGATGTTCTTGGGATCGGCCACTCGATGGGATGGTCCAGCGTCCTCATTCCAGGGTCTGGAGAGCCT
AACTTTGATTCTTGGGTGGCGAATCCGTTTGAGACGTCGAAGCAAAGACGTGAGAAGGAAGTACACTTGCTTCTTGATAA
GCTTCCACCTGAGACGATCATGCTTGATCCTTCGAAGATTGGGGCCATGAGGCCGTCGAGGAGGAAGGAGAGGCCTACGA
GAGGGGAGATTGAGGCGGAGAAGGAGGTGGCGATAGAGGCGGCGAAGAGCGTTGAGATGAAGACGAAGACGAAAGGGAGG
AATAAGCCGAGTAAGAGGACTAAGAAGAAGAAGGAGATGGTGGAGAATGCGAAGAAGACGTTCCCTGAGCTGGAACATAG
CAATATTGCGGGGAAGAAGAGGAGGATCGGTGAAGATGCTGCGGCTGAGTTGCCTGCAAGTTTGAAAAGGTTTGCTAGAA
AAAACTGA