Details for Chinese cabbage Locus Brara.A03474

Position : A01 ( 5`- 28415516 .. 28418286 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03474

Protein [Map View]
MTMEKEFDSKLTLQGNNGNDGGASISRSKSFAFKAPQENFTIQDFELDKIYGVGSYSKVVRAKKKENGAVYALKIMDKKF
ITKENKTAYVKLERIVLDQLDHPGIVKLFFTFQDSFSLYMALESCEGGELFDQITRKGRLSEDEARFYSAQVVDALEYIH
TMGLIHRDIKPENLLLTSDGHIKIADFGSVKPMQDSQITLLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALG
CTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEEARDLIDRLLDTDPSRRPGAGSDGYASLKRHPFFKGVDWKNV
RSQTPPKLAPDPSSQSASPERDGSPWNPTHVGDASVTQNDGHGGVSSTTESSGSITRLASIDSFDSRWQQFLEQGESVLM
ISAVKKLQKITSKKVQLILTNKPRLIYVDPSKLIVKGNIIWSDNSNDLNVQVSSPSHFKICTPKKVLSFEDSKQRALQWK
KAIETLQNR*

DNA
ATGACAATGGAGAAAGAATTCGATTCAAAGCTCACCCTCCAAGGCAACAACGGCAACGACGGTGGCGCGAGCATATCCAG
AAGCAAGAGCTTCGCGTTCAAAGCTCCTCAGGAGAATTTCACAATCCAGGATTTCGAGCTCGACAAGATCTATGGCGTTG
GCTCTTACTCAAAGGTTGTTAGGGCGAAGAAGAAGGAGAACGGAGCTGTGTACGCGTTGAAGATCATGGACAAGAAGTTC
ATCACCAAGGAGAATAAAACAGCTTATGTTAAGCTTGAGAGGATTGTTCTTGATCAGCTTGATCATCCTGGGATTGTTAA
ACTCTTCTTCACGTTTCAAGATTCGTTCTCACTGTATATGGCGCTTGAGTCTTGTGAAGGTGGGGAGCTTTTCGACCAAA
TCACTAGAAAAGGTCGCTTATCAGAGGATGAAGCTCGGTTTTATAGTGCACAAGTTGTGGATGCTCTTGAGTATATACAT
ACGATGGGACTCATACATAGAGATATAAAGCCGGAGAATCTGTTGCTGACTTCAGATGGACACATTAAGATTGCTGATTT
TGGTAGTGTAAAGCCTATGCAAGACAGCCAGATCACTCTACTTCCCAATGCTGCTTCCGATGATAAGGCTTGCACTTTTG
TTGGTACGGCGGCATACGTTCCTCCTGAAGTTCTCAACTCCTCCCCAGCAACTTTCGGAAACGATCTCTGGGCACTCGGC
TGCACTCTATACCAAATGCTTTCAGGAACTTCTCCATTCAAGGATGCAAGTGAATGGCTAATTTTCCAAAGGATTATAGC
GAGAGATATAAAGTTCCCTAATCATTTCTCAGAAGAAGCAAGAGACCTCATCGACCGATTACTTGATACAGATCCTAGTA
GAAGACCAGGAGCTGGATCAGATGGTTATGCTTCCCTCAAGAGACATCCTTTCTTCAAAGGTGTTGACTGGAAGAACGTT
AGATCGCAAACTCCACCAAAACTAGCTCCAGATCCTTCGTCTCAATCAGCATCTCCAGAGAGGGACGGTTCTCCATGGAA
CCCAACACATGTTGGAGATGCTTCAGTCACGCAGAACGATGGACACGGTGGCGTCTCTTCAACTACTGAATCCTCTGGTT
CAATAACCAGGCTTGCCTCTATAGACTCTTTTGATTCGAGATGGCAACAATTTCTTGAACAAGGAGAATCGGTTCTAATG
ATATCAGCAGTGAAGAAGCTACAGAAGATCACAAGCAAGAAGGTGCAGCTAATACTCACCAACAAACCGAGACTGATCTA
TGTGGATCCATCGAAGCTTATTGTGAAAGGGAATATCATCTGGTCTGATAACTCCAACGACCTCAATGTTCAAGTCTCGA
GTCCTTCGCATTTCAAGATTTGCACACCTAAGAAGGTTTTATCGTTTGAAGACTCGAAACAACGAGCTTTGCAGTGGAAA
AAGGCAATTGAAACTCTTCAAAACCGTTGA