Details for Chinese cabbage Locus Brara.A03473

Position : A01 ( 5`- 28410131 .. 28415118 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03473

Protein [Map View]
MTPPRPPSGRQRPLRYYSDSERTEGGSGSWDTLEWNKLDSQQTASGSSSTSFANLSCLLESERVIVEGYGVVLINTDEAG
TLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKTALKVQSNNRQSDKNPPRRLLQVTGKDMRIIVYGFRPKTKQRRSV
FDALLRCTKPERVWDLYTFACGPSKFGNANPKERLLNEYFRLLGKSSVRASMDMIEDGSFTLENELWRISDLNSNYNLCQ
TYPFAFMVPKSISDEELLQACSFRAKCRLPVITWCQPGSGAVIARSSQPLVGLMMNMRSNFDEKLVAAFCTQLGANKGER
RKLYIADARPRKNALANGAMGGGSESSSNYFQSPIVFFGIDNIHAMRESYSRLRDYLDMHGATSSDGRSSFLRHTGWTWG
GGNLSSMSASVSLLGDSGWLIHIQNVLAGAAWIAARVAVESASVLVHCSDGWDRTTQLVSLACLMLDPYYRTFAGFQALV
EKDWLAFGHPFSDRVGMPNISGSGNFDFPRQSSSAGSYPSSPVRQSTQSGASQSPSSSHAQNNYSPIFTQWVDSVSQLMR
MYPCAFEFSPTFLVDFMDCLLSCRFGNFLCNSEKERQQCAIAEACGCIWAYLTDLRSLATTSHVHCNPFYDSLKYDGPLL
PPAASLAPTLWPQFHLRWACPEEAKAADIEVQCRAMRAKYSEMQKEKETTERRVDEISFAMESLSAELLRERRMSWSARE
SAKRATKEYRALTRAVQSLGCKVNFTTSDVEDAPLETNNNNNNNNSRRRDRQGNNSDVSVSISLMSEENRSENQVGRVCE
ALCPLRTREGVCRWPEAGCAHLGSQFVGLKTNFDAFDRLSIHESYFKSE*

DNA
ATGACGCCGCCGAGACCACCGTCAGGGAGACAAAGACCGCTGCGTTATTATTCAGATTCAGAGAGGACCGAAGGAGGTAG
CGGTAGTTGGGACACCCTCGAATGGAACAAACTCGATTCGCAGCAGACAGCTTCAGGTTCAAGTTCAACATCCTTCGCGA
ATTTGAGTTGCTTGCTCGAATCCGAGAGGGTCATCGTTGAGGGTTATGGAGTTGTACTTATCAACACCGATGAGGCAGGG
ACCTTGTTGGTGACAAACTTTCGTATTCTCTTTTTGAGTGAAGGTACTAGGAAGGTCATCCCACTAGGAACAATCCCGTT
GGCTACTATTGAGAAGTTTAACAAAACGGCGCTGAAAGTTCAATCAAACAACCGTCAGTCCGACAAGAATCCACCGAGAC
GTCTTTTACAGGTCACTGGCAAAGACATGAGGATCATTGTTTATGGCTTTCGTCCTAAAACCAAACAGAGGCGTTCTGTG
TTTGATGCGTTACTGAGGTGTACCAAGCCGGAGAGAGTATGGGATCTTTACACTTTTGCTTGTGGGCCTTCCAAGTTTGG
TAACGCAAACCCAAAGGAAAGATTGCTTAATGAATATTTCCGGCTTCTTGGAAAAAGTTCGGTACGAGCATCGATGGATA
TGATTGAAGATGGATCATTCACACTGGAGAATGAGCTGTGGCGTATAAGTGACCTGAACTCCAATTATAACCTGTGTCAG
ACTTACCCGTTCGCCTTTATGGTTCCGAAATCTATAAGTGATGAAGAGCTGCTCCAGGCGTGTTCTTTCCGGGCAAAATG
TCGCTTACCTGTGATCACGTGGTGTCAGCCAGGCAGTGGAGCTGTAATTGCACGCTCATCACAACCTTTAGTGGGTCTTA
TGATGAATATGAGGAGTAATTTTGATGAGAAGCTTGTTGCTGCATTCTGCACTCAGCTTGGTGCTAATAAGGGAGAACGA
AGGAAGCTTTATATTGCCGATGCGCGACCTAGGAAAAATGCATTAGCAAATGGAGCAATGGGAGGCGGCTCAGAATCATC
TTCAAATTATTTTCAGTCTCCAATTGTTTTCTTTGGCATTGACAACATACATGCGATGAGGGAGAGCTATTCCCGACTCA
GAGATTATTTAGATATGCACGGTGCAACATCTTCTGATGGGAGATCATCGTTCTTGAGACATACTGGTTGGACTTGGGGA
GGAGGTAACCTTAGTAGCATGTCTGCTTCCGTGTCTTTACTTGGAGACAGTGGTTGGTTGATACACATCCAGAACGTCTT
AGCTGGTGCCGCATGGATTGCTGCACGTGTCGCAGTGGAGTCGGCTTCGGTTCTTGTGCACTGCAGTGATGGATGGGACA
GAACAACTCAGCTCGTTTCTCTTGCATGCTTGATGCTTGATCCATACTACAGAACCTTTGCTGGGTTTCAGGCTCTTGTG
GAAAAAGATTGGCTTGCTTTTGGTCACCCGTTTTCAGATCGTGTAGGAATGCCTAACATATCAGGATCTGGTAACTTTGA
CTTTCCAAGGCAGTCTTCTTCTGCTGGAAGCTACCCTTCATCTCCAGTGCGTCAGTCCACGCAATCAGGAGCCTCACAAT
CTCCAAGCTCTTCCCATGCACAGAACAATTATTCTCCTATATTTACGCAGTGGGTTGATAGTGTTTCACAGCTAATGCGG
ATGTATCCTTGTGCTTTTGAATTTTCTCCGACTTTCCTTGTAGATTTCATGGATTGCTTGCTTTCATGTCGTTTTGGGAA
CTTCTTATGCAACAGTGAAAAAGAGAGGCAGCAATGTGCGATTGCTGAAGCATGTGGATGCATATGGGCCTACTTGACTG
ATCTTCGCTCTCTCGCTACAACGTCTCATGTCCATTGTAACCCATTCTACGATTCTCTAAAATACGATGGCCCGTTACTA
CCTCCAGCAGCATCTCTAGCTCCAACCCTTTGGCCTCAGTTCCATCTCCGGTGGGCTTGTCCCGAGGAAGCTAAAGCTGC
AGATATCGAGGTCCAGTGTAGAGCCATGAGGGCGAAGTATTCAGAAATGCAGAAGGAGAAAGAGACAACAGAGAGAAGAG
TGGATGAGATCTCTTTTGCAATGGAGTCATTAAGCGCAGAGCTGCTAAGAGAGAGGCGTATGAGTTGGTCCGCTAGAGAA
TCAGCAAAACGAGCCACTAAGGAATACAGAGCTTTGACCAGAGCAGTGCAATCACTCGGCTGCAAGGTTAACTTCACCAC
ATCTGATGTGGAAGACGCCCCTCTGGAGACTAATAACAATAATAATAATAATAATTCTAGGAGGCGAGACAGACAGGGAA
ACAACTCGGATGTTTCTGTATCTATCTCGCTAATGTCGGAAGAAAACAGAAGTGAAAACCAGGTGGGGAGAGTTTGTGAA
GCGTTGTGTCCACTGCGGACAAGGGAAGGAGTGTGTCGGTGGCCTGAAGCTGGATGTGCTCATCTCGGAAGTCAGTTTGT
TGGTTTAAAAACTAACTTTGATGCGTTTGATAGGCTTTCCATCCATGAAAGCTATTTCAAATCTGAATGA