Details for Chinese cabbage Locus Brara.A03468

Position : A01 ( 5`- 28390173 .. 28391111 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03468

Protein [Map View]
MGSKQWTRYEDKLFESLLLKFPENTPNRFEAIAGHLNVPLEEVKHYYKALVHDINLIESDQYPTTNYPDGIPSQTKHMEK
EKKRGKPWTEEEHRLFLEGLDKYGKGDWKNISRKIVMTKTPMQVASHAQKYILRQEAKEKAKKRSSIHDITLIDLAANNV
TAPRSDLDSTMGQPPSDQQVPQDHHHSDEDYLIEKMYT*

DNA
ATGGGTTCGAAGCAGTGGACGAGGTATGAGGACAAACTGTTTGAGAGTCTTCTGTTGAAGTTCCCAGAAAATACTCCCAA
TAGGTTTGAGGCTATCGCCGGACATCTTAATGTACCGCTTGAAGAGGTGAAGCACTACTACAAAGCTTTGGTCCACGATA
TTAACCTTATCGAATCGGATCAATATCCTACTACTAATTATCCAGATGGGATCCCATCCCAGACCAAACATATGGAGAAA
GAAAAAAAGAGGGGAAAACCTTGGACAGAAGAGGAACACAGGCTTTTTCTGGAGGGGCTAGATAAATATGGGAAAGGAGA
TTGGAAGAACATATCGAGAAAGATTGTGATGACAAAGACCCCAATGCAAGTCGCAAGCCATGCACAAAAGTATATCCTGA
GGCAAGAGGCCAAGGAGAAGGCAAAGAAACGCTCCAGTATCCATGACATAACTTTGATAGATCTTGCTGCTAACAATGTA
ACCGCACCTCGATCCGACTTGGACTCTACGATGGGCCAGCCACCTTCTGATCAGCAGGTGCCTCAAGACCATCATCATTC
CGACGAAGACTATTTGATTGAGAAGATGTATACGTAA