Details for Chinese cabbage Locus Brara.A03465

Position : A01 ( 5`- 28374022 .. 28375045 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03465

Protein [Map View]
MAANSWTQEENEQFKDAVQRFSAFFPDRFECIAQRLQKSVVDVKEHYQEMVDDLLEIRSSQIALSNGMFDAVEPSWCRIE
KPIWDIEEHEWFLIGLEQFGRNCDKIAVLLVTKTPMQVAIYARNFFYWHNSKNNVLKRRRTMDITMGDLRVDSSGLQNRT
MRGINRDSTGQEERPMGGVNVGLNWSTREPSSFAAARQQGLGALETGQDAHF*

DNA
ATGGCTGCGAATTCATGGACACAAGAAGAGAACGAGCAGTTCAAGGATGCAGTGCAGAGGTTCTCTGCGTTTTTTCCCGA
TCGGTTCGAGTGTATAGCCCAGCGTCTACAGAAATCGGTGGTCGATGTTAAGGAGCATTACCAGGAAATGGTCGATGATC
TTCTAGAGATCAGATCGAGTCAAATAGCTTTATCTAATGGGATGTTCGATGCAGTTGAGCCGAGTTGGTGCCGGATCGAG
AAACCTATATGGGACATAGAGGAACATGAATGGTTCCTGATCGGGTTAGAGCAGTTTGGGAGAAACTGTGACAAAATAGC
GGTCTTATTGGTTACCAAAACCCCGATGCAAGTGGCTATCTATGCACGTAACTTCTTCTATTGGCACAACTCAAAGAACA
ATGTCTTGAAGCGGCGGAGAACCATGGACATAACTATGGGGGACCTCAGAGTAGACTCATCTGGCCTACAAAACAGAACT
ATGAGGGGCATCAATAGGGACTCAACTGGCCAAGAAGAGAGACCTATGGGGGGCGTCAATGTGGGACTCAACTGGTCAAC
AAGAGAGCCTAGTTCCTTCGCAGCCGCACGACAACAAGGGCTAGGCGCGCTGGAAACCGGTCAGGATGCTCATTTCTGA