Details for Chinese cabbage Locus Brara.A03464

Position : A01 ( 5`- 28368066 .. 28371546 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03464

Protein [Map View]
MEAHYRNHGGDTSFSSLRVYLNSLSHTPSRFSRRAISVSTSYDEMSRVRAVSGEQMRRTLRWYDLVGLGIGGMIGAGVFV
TTGRASRLLAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAFITGANLIMDYVMSNAAVSRGF
TAYLGSAFGLSTSEWRFVVSGLPNGFNEIDPVAVLVVLAVTFIICYSTRESSKVNMVLTALHIAFIVFVIVMGFWKGDKK
NLTRPANPENPSGFFPFGASGVFNGAAMVYLSYIGYDAVSTMAEEVRDPVKDIPMGISGSVAIVIVLYCLMAISMSMLLP
YDLIDPEAPYAAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRVVPTWFAKVHPKTSTPVNASAFL
GIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFRRYVAVGYTRPWPTLSFLCLFSITSTVFTLVWKLAPSGSPKWF
MLGASGVAAIAIVQIFHCVVPQARTPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLAVLVYVFYSVHASY
DAEGDGSLDFKDVESFEGINRILS*

DNA
ATGGAGGCCCATTACCGCAACCACGGCGGAGACACCTCCTTCTCCAGCCTCCGCGTCTACCTCAACTCTCTCTCCCACAC
TCCCTCCCGCTTTTCCCGCCGCGCTATCTCCGTCTCCACCTCGTACGACGAGATGAGCCGCGTCCGCGCCGTCTCCGGCG
AGCAGATGCGCCGCACTCTCCGCTGGTACGACCTCGTCGGACTCGGAATCGGAGGCATGATCGGCGCCGGCGTCTTCGTC
ACCACCGGCCGCGCTAGCCGACTCCTCGCCGGTCCCTCGATCGTCGTCTCCTACGCCATCGCCGGCCTCTGCGCTCTCCT
ATCCGCCTTCTGTTACACCGAGTTCGCCGTTCACCTCCCCGTCGCCGGCGGCGCCTTCAGCTACATCCGTATCACATTCG
GCGAGTTCCCGGCGTTTATAACCGGAGCGAATCTTATAATGGACTACGTCATGTCAAACGCCGCCGTTTCGAGAGGATTC
ACGGCTTATCTCGGATCCGCATTCGGACTATCCACCTCCGAGTGGAGATTCGTCGTCTCCGGTCTCCCTAACGGATTCAA
CGAAATTGATCCCGTCGCCGTTCTCGTCGTCCTCGCCGTCACGTTCATCATCTGCTACAGCACGAGGGAGAGTTCGAAGG
TGAATATGGTGTTAACGGCGTTACACATTGCATTCATCGTGTTCGTGATCGTGATGGGGTTTTGGAAAGGAGACAAGAAA
AATTTAACCCGACCCGCTAACCCGGAGAATCCGTCCGGGTTCTTCCCTTTCGGAGCTTCGGGTGTGTTTAACGGAGCGGC
GATGGTTTACTTGAGTTATATAGGATACGACGCCGTTTCGACGATGGCTGAAGAAGTGAGAGACCCGGTCAAAGACATCC
CCATGGGAATATCCGGCTCGGTCGCTATCGTCATTGTACTTTACTGCTTAATGGCTATCTCCATGTCCATGCTCCTCCCT
TACGATCTGATAGATCCTGAAGCACCGTACGCGGCGGCGTTTAGCAAATCGGAAGGTTGGGAATGGGTGACGAAGGTGGT
TGGGATTGGAGCAAGTTTTGGGATACTGACGTCGTTGTTGGTGGCGATGTTGGGTCAGGCTCGGTACATGTGCGTCATCG
GACGGTCAAGAGTGGTCCCCACTTGGTTCGCTAAGGTCCATCCCAAGACATCAACACCAGTCAACGCTTCCGCTTTTCTT
GGAATCTTCACGGCGGCGCTCGCACTCTTTACAGACCTGAACGTTCTCTTAAACCTCGTTTCAATCGGAACCCTCTTCGT
CTTTTACATGGTTGCAAACGCTGTTATATTCCGGCGTTACGTAGCGGTTGGATACACCAGACCCTGGCCTACACTCTCCT
TCCTTTGTCTATTCTCTATAACCTCAACTGTCTTCACCTTAGTCTGGAAACTCGCACCGTCCGGTTCACCAAAATGGTTC
ATGCTTGGAGCCAGTGGTGTGGCGGCTATAGCCATCGTGCAGATATTCCATTGTGTTGTGCCTCAAGCTAGAACTCCTGA
GTTTTGGGGAGTACCGTTGATGCCGTGGACTCCTTGCGTTTCGATATTTTTGAACATATTTTTGCTCGGATCGCTGGATG
CTCCTTCGTATATAAGATTCGGGTTCTTCTCGGGGTTGGCAGTGCTCGTGTATGTGTTTTATAGTGTTCATGCGAGCTAT
GATGCTGAAGGAGATGGGTCTCTTGATTTCAAAGACGTGGAAAGTTTTGAAGGAATTAACAGAATTTTGAGTTGA