Details for Chinese cabbage Locus Brara.A03461

Position : A01 ( 5`- 28352490 .. 28354113 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03461

Protein [Map View]
MEQPPDRTKRPWRFTTFVYTSSILFLLLSILILSFTTTDLYKSQTLRFTFTTNRIYTYLQSLSSNSKSETPNPSHCVLWM
APFLSSGGYSSEAWSYILSLHHNLKPPKFRITIEHHGDLQSIEFWNGLATETKELAIEMHRTECRPNETIVVCHSEPGAW
YPPLFETLPCPPYGYYGDFAAVIGRTMFETDRVNGEHVERCNGMDRVWVPTEFHVASFVKSGVDSSKVVKIVQPVDVEVF
DPLKYEPLDLVEIGDLVLGGSGVRGLGLGFVFLSVFKWEKRKGWDVLLKAYLREFSGEDNVALFLLTNAYHSDRDFGNKI
VDFVKELNFKEGEDGFPFVYVIDKHIAQVDLPRLYKAADAFVLPTRGEGWGRPIVEAMAMSLPVIATNWSGPTEYLTEEN
GYPLVVEEMSEVKEGPFEGHRWAEPSVDKLRVLMRRVMSEPDEAKVKGKRGREDMVKKFAPEVVAKVVADQIERIFEEKI
RR*

DNA
ATGGAGCAACCACCAGATCGAACGAAGCGACCATGGAGATTCACCACGTTCGTCTACACTTCTTCGATCTTATTCCTTCT
CCTTTCTATACTCATACTCTCCTTCACCACAACCGATCTCTACAAATCCCAAACTCTGAGATTCACCTTCACCACGAATC
GCATCTACACCTATCTTCAATCTCTCTCCTCCAATTCCAAATCCGAAACTCCAAACCCATCGCACTGCGTATTATGGATG
GCTCCTTTCCTCTCGAGCGGCGGCTACAGCTCCGAAGCATGGTCCTACATCTTATCCCTCCACCACAATCTCAAACCCCC
TAAGTTCCGAATCACAATCGAGCACCACGGCGATCTCCAATCAATCGAGTTCTGGAACGGTTTAGCCACAGAGACGAAAG
AGCTCGCCATCGAAATGCACAGAACAGAGTGTAGACCCAACGAGACGATCGTCGTCTGCCACAGCGAGCCTGGCGCGTGG
TATCCACCTTTGTTCGAGACTCTTCCTTGTCCTCCTTACGGTTACTACGGAGACTTTGCGGCTGTGATTGGTAGAACAAT
GTTCGAGACTGATAGAGTCAATGGCGAGCACGTGGAGCGGTGTAACGGAATGGATCGTGTTTGGGTTCCTACTGAGTTTC
ATGTAGCGTCGTTTGTGAAAAGTGGTGTTGATTCGTCAAAGGTTGTTAAGATTGTGCAGCCTGTTGATGTTGAGGTGTTT
GATCCTTTAAAGTATGAGCCTTTGGATTTGGTGGAGATTGGGGATTTGGTTTTGGGTGGTTCTGGAGTTAGGGGTTTGGG
TTTGGGGTTTGTGTTCTTGAGTGTGTTTAAGTGGGAGAAGAGGAAAGGTTGGGATGTGTTGTTAAAAGCTTACTTGAGAG
AGTTCTCTGGTGAAGACAATGTTGCTCTTTTCTTGCTGACAAACGCTTATCATTCAGATAGAGACTTTGGGAACAAGATT
GTTGATTTTGTGAAAGAGTTGAATTTTAAAGAGGGTGAAGATGGTTTCCCTTTTGTTTATGTGATTGATAAACACATAGC
TCAGGTTGATTTGCCTCGGTTGTACAAAGCGGCTGATGCGTTTGTGTTGCCTACAAGAGGAGAAGGATGGGGACGGCCTA
TAGTGGAAGCTATGGCGATGTCTTTGCCTGTGATTGCTACGAACTGGTCTGGGCCCACGGAGTATCTGACGGAAGAGAAT
GGTTATCCGTTGGTGGTTGAGGAGATGAGTGAAGTGAAGGAAGGTCCTTTTGAAGGGCATCGATGGGCAGAGCCGTCTGT
TGATAAGCTTAGGGTGCTGATGAGGCGTGTGATGAGTGAACCTGATGAAGCGAAGGTTAAAGGGAAGCGTGGAAGAGAGG
ATATGGTCAAGAAGTTTGCTCCTGAGGTGGTGGCTAAGGTTGTTGCGGATCAAATCGAGAGAATCTTTGAAGAGAAAATA
AGAAGATGA