Details for Chinese cabbage Locus Brara.A03460

Position : A01 ( 5`- 28345898 .. 28350351 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03460

Protein [Map View]
MASAAREESSNHPYYGGGLGAGGKFRKPPARRSRKTPYDRPPTSVKSPRPGIGEDRGWLSKLVDPAQRLITCSAHRLFAS
VFRKRLVSGETPLQSPEQKQFPERDVMQEAKVGHRENTSALSMKNDLVRVHEANGLGNPSKDGYTDLEKVLKEKTFTRSE
VDRLTSLLRSKAADSSTVNWDQRNEASVARYPPPHGRDMVHPYSGFMNTLVSTPRGSSRALDECIASPAQLAKAYMCSRP
SEVTPSMLGSHGQAGREDYVSLNRTPFPSKSRTMSLVPKLSGPRPLENGFLTPRSRGRSAVYSMARTPYSRPQSTVKNGS
LFQASPSTWEESLASGSRKGFQSGLKRRSSLLDTDIESVGPVRRIRQKSNLSSRSLALPVSESPLSVRATGGQNMTHTSR
DVGDIPGSNFNLVPSTSRELASKILQQVNKMVSPKKKSPSRLSPSMLRGPALKSLQNVEAPKFLDNLPEKKANLPGSSHQ
KQEKIRETGARGFSGLKEKTGDAAGDTSKAGSSKDHETCVNGAYLPLTSSVEEHPPKKRAFRMVADEDFDGHGEPSTPFQ
EAEKQNTLKVEKDVDISMRRGKKPLISSEVMASTSYIPNGNVSQSTCNGSLETGRSQFSALPIEAVQQSNMPSEPTSKFI
QGTEKSSISPAKLASEVEDISREEHTKAAAVFPSTSSSPAATDLLNQNTGQSADIKLEKLRSFAFGKPTELEKTVSNSAS
RIKSTTSAESTLNGSMFSGEANAISELSSTNSFASSSGTSSTSPFGTNWQAPNSSPAFGSSFTTSSSQTFSFGGSSAATG
SSTSAPIFLSSTAPAIPQQSVFSNPAPSTTPSQSPFGNLTPGFFPPPNTNGFNNNQHMIIEDSMAKDTEQANKASMVQPP
TFGQQPQPSFSFGGAPATPPPSMANPFQFGVQPIASTQQNPSLFQASPGLDFQGGGSFSLGSTGGGDKSGRRIFKAKKTN
RKR*

DNA
ATGGCGAGCGCGGCACGGGAAGAGAGCAGCAACCACCCCTACTACGGCGGCGGGTTAGGAGCCGGCGGAAAGTTCCGGAA
ACCGCCGGCGAGAAGGTCTCGTAAAACTCCGTATGATCGACCACCGACCTCCGTGAAGAGTCCTAGACCTGGGATCGGAG
AAGACAGAGGCTGGTTGTCGAAATTGGTGGATCCGGCTCAGAGGCTTATTACGTGTAGCGCTCATAGGCTCTTCGCTTCT
GTGTTTCGGAAACGCCTCGTCTCAGGTGAGACGCCTTTACAGTCTCCGGAGCAGAAGCAGTTTCCAGAAAGAGATGTGAT
GCAGGAGGCTAAGGTTGGACACAGGGAGAATACTTCTGCTTTGTCTATGAAGAATGATTTGGTTCGGGTACACGAAGCCA
ATGGATTAGGCAATCCAAGCAAGGATGGATATACAGATCTTGAGAAAGTTTTGAAGGAGAAAACTTTTACAAGATCTGAA
GTTGACCGATTAACTAGCCTGCTACGTTCGAAAGCTGCTGATTCATCCACTGTAAACTGGGATCAGAGAAATGAAGCGAG
TGTTGCGAGATATCCACCACCACATGGGAGGGATATGGTGCATCCATATAGTGGATTTATGAACACCCTTGTTTCAACAC
CTCGTGGAAGTTCGAGGGCTCTCGATGAGTGCATTGCTTCGCCGGCGCAGCTTGCAAAAGCCTACATGTGTAGCAGACCT
TCAGAAGTTACTCCTTCTATGCTGGGATCACATGGTCAAGCGGGTAGGGAAGATTATGTTTCCCTGAACAGAACCCCATT
TCCGTCAAAGTCACGTACAATGTCACTGGTACCAAAGCTTTCTGGACCAAGACCTCTGGAAAATGGTTTCCTCACCCCTA
GATCTCGGGGAAGATCTGCTGTTTATAGCATGGCCAGAACACCATACTCTAGGCCTCAGTCCACTGTTAAGAATGGTTCT
CTTTTCCAGGCATCTCCAAGCACATGGGAAGAAAGCTTAGCTTCTGGTTCTAGAAAAGGGTTTCAATCGGGTCTCAAACG
GAGGAGCTCACTCTTGGATACTGATATAGAATCTGTTGGCCCTGTTAGGAGGATTCGCCAGAAATCCAACCTTTCATCTA
GAAGCTTGGCTCTGCCTGTCTCGGAAAGCCCACTTTCTGTTCGTGCCACTGGTGGACAAAACATGACACATACATCTAGA
GATGTAGGGGATATTCCTGGTTCAAATTTTAACCTTGTCCCTTCCACGTCGAGGGAGCTGGCTTCAAAAATATTGCAGCA
AGTTAATAAAATGGTTTCACCGAAGAAGAAATCACCAAGTAGGTTATCTCCATCTATGCTACGAGGCCCGGCTCTCAAGA
GTCTTCAGAATGTGGAGGCGCCAAAGTTCTTGGATAATCTTCCTGAGAAGAAGGCAAATTTGCCAGGTTCTAGTCATCAA
AAGCAGGAAAAAATTAGAGAGACTGGTGCCAGAGGGTTTTCGGGTCTGAAAGAGAAGACTGGTGATGCTGCTGGGGACAC
AAGCAAAGCAGGTTCCAGTAAAGATCACGAGACTTGTGTTAATGGTGCTTATTTGCCTCTCACAAGTTCTGTGGAAGAGC
ATCCTCCAAAAAAACGAGCATTTCGGATGGTAGCGGATGAGGATTTTGATGGTCATGGGGAGCCATCTACTCCATTTCAA
GAGGCAGAAAAACAGAATACCTTGAAAGTGGAGAAAGATGTTGATATCAGCATGCGTAGAGGGAAGAAACCACTTATTTC
GTCTGAGGTCATGGCCTCTACTTCATATATTCCTAATGGCAACGTCTCTCAGAGTACTTGTAATGGATCTCTGGAAACTG
GAAGAAGCCAATTTTCTGCTTTACCCATTGAAGCTGTTCAGCAAAGTAATATGCCCTCTGAGCCAACTTCTAAGTTCATC
CAAGGGACTGAGAAGTCGAGTATTTCTCCCGCCAAGCTAGCCTCAGAAGTGGAAGATATCTCTCGGGAAGAGCATACAAA
AGCTGCTGCTGTGTTTCCCAGCACCTCCTCGTCACCGGCGGCTACTGACTTACTAAATCAAAACACGGGTCAATCTGCAG
ATATCAAGTTAGAAAAGCTGCGCAGCTTTGCTTTTGGAAAGCCAACTGAATTAGAGAAAACTGTTAGCAACAGTGCTTCG
AGAATTAAGTCAACTACCTCAGCTGAATCAACCCTCAATGGTAGTATGTTCTCAGGCGAAGCAAACGCTATCAGTGAACT
GAGTTCGACAAACTCCTTTGCAAGCTCTAGTGGTACATCGAGCACTTCCCCATTTGGTACAAACTGGCAAGCTCCCAACT
CTTCTCCAGCCTTTGGTTCCTCATTCACCACTTCCTCATCTCAAACCTTTTCATTCGGAGGATCTTCTGCTGCTACCGGT
TCAAGCACTTCTGCTCCCATCTTTCTCAGCTCAACCGCTCCTGCCATTCCTCAACAGTCAGTGTTTAGTAACCCGGCTCC
CTCAACGACTCCGTCACAGTCTCCGTTTGGAAACTTAACACCCGGGTTTTTCCCACCACCAAATACAAATGGTTTCAACA
ATAACCAACACATGATCATTGAAGACAGTATGGCAAAAGACACAGAGCAAGCTAATAAAGCATCCATGGTACAACCGCCA
ACGTTTGGACAACAGCCTCAACCAAGCTTTTCCTTTGGCGGAGCACCAGCAACGCCACCTCCATCAATGGCTAACCCGTT
CCAGTTTGGAGTCCAACCTATTGCAAGCACACAACAGAACCCATCACTTTTCCAGGCATCCCCCGGTCTAGACTTCCAAG
GAGGTGGGAGCTTCTCACTGGGAAGCACTGGTGGCGGTGACAAGTCAGGCCGCAGAATCTTCAAAGCGAAGAAAACCAAC
AGAAAGAGATAA