Details for Chinese cabbage Locus Brara.A03451

Position : A01 ( 5`- 28306421 .. 28307929 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03451

Protein [Map View]
MTESTFSIANPPEMPDLNPNTLPDPEMISVPPLDPLFLSASDPISDLSFFFDDENGDFADLDFSFDDSVDFVDFDLDAEP
PVAISEELGSSGDQSPEAIANHANLDSPETKNVDRGLEDRSDSVHSQVSSQGSKTSGGCDTLSSPENSSVSKSKSTSKRK
KGDSGGDYRSFKYQKSDEKSASPVEEDDEKKKVRLIRNRESAQLSRLRKKQYVEELQGKVKTMNSTIAELNGKISYVMAE
NAALRQQMMAAAAAGAPPPMNPYMAAPPLPYQWMPYPPPPYPYGSQIPIPKLPLPSCSRPKKGEGKSKLKKAASISFIGI
MFFMFLFGTLVPFMNVDNGGDSGLAKYEGRRYYDEHRGKVLMVGDGSDVRRESVCSGRDSCGGVEGRVGNSSEPLFASLY
VPRNNGLVKIDGNLIIHSVLASEKAKKNISETIKSKEAELTVPGIPVPDVRGNGAMLPHSSKALSSSGSPDGKRLQQWFH
EGGAVLLNGVNLD*

DNA
ATGACGGAGTCCACATTCTCTATCGCTAACCCACCGGAGATGCCTGATCTGAACCCTAATACGCTACCAGATCCCGAGAT
GATCTCAGTCCCGCCGCTAGATCCTCTCTTCCTCTCTGCTTCCGATCCGATTTCCGATCTAAGCTTCTTCTTCGACGACG
AGAACGGAGACTTCGCGGATTTGGATTTCTCGTTCGACGATTCCGTTGATTTCGTCGATTTCGACCTCGACGCGGAGCCC
CCGGTGGCGATCTCAGAGGAGCTCGGAAGCTCTGGAGATCAGAGTCCAGAAGCGATCGCAAACCATGCGAATCTCGATTC
ACCGGAGACGAAGAACGTCGATAGAGGTTTAGAAGATCGATCTGACTCTGTTCATTCTCAGGTCTCGTCGCAAGGCTCGA
AGACGTCAGGCGGTTGCGACACGTTATCCTCCCCTGAGAACTCTTCTGTGAGCAAGAGCAAGAGCACGAGCAAGAGGAAG
AAGGGAGACTCTGGAGGAGATTACAGAAGCTTCAAGTACCAAAAGTCTGATGAGAAATCAGCTTCTCCTGTGGAGGAGGA
CGATGAGAAGAAGAAGGTGAGGCTGATTAGGAACCGTGAGAGCGCTCAGCTTTCGAGATTAAGGAAGAAGCAATACGTTG
AGGAGCTTCAAGGGAAAGTGAAGACTATGAACTCCACCATTGCTGAATTAAACGGGAAGATATCGTATGTGATGGCTGAG
AATGCAGCGCTAAGGCAGCAGATGATGGCTGCAGCTGCTGCTGGTGCTCCTCCTCCTATGAATCCTTACATGGCTGCACC
GCCTTTACCTTATCAGTGGATGCCGTATCCTCCTCCGCCGTATCCTTATGGATCACAGATTCCCATTCCTAAATTGCCTC
TCCCGAGTTGTAGTAGGCCGAAGAAGGGAGAGGGGAAAAGCAAGCTCAAGAAGGCTGCTAGTATCAGTTTTATTGGGATT
ATGTTCTTTATGTTCTTGTTTGGTACGTTGGTTCCGTTTATGAATGTTGATAATGGAGGAGATAGTGGTTTGGCTAAGTA
TGAGGGTCGTAGGTATTATGATGAGCATAGAGGGAAGGTTCTTATGGTTGGTGATGGGTCTGATGTTAGAAGAGAAAGTG
TCTGTTCTGGTAGAGATAGTTGTGGGGGAGTAGAAGGACGAGTGGGCAATTCCAGTGAGCCTCTCTTTGCTTCTCTCTAC
GTTCCAAGGAACAATGGGCTTGTGAAGATCGATGGGAACTTGATCATTCATTCTGTTTTGGCTAGCGAGAAAGCTAAGAA
GAATATTTCTGAGACGATAAAAAGCAAAGAAGCTGAGTTGACGGTTCCTGGTATCCCTGTTCCTGATGTGAGAGGAAATG
GAGCAATGCTTCCACATTCTTCAAAGGCTCTCTCTTCTTCTGGTTCGCCTGATGGGAAAAGACTTCAGCAGTGGTTTCAT
GAAGGTGGCGCAGTTCTACTAAATGGAGTAAACTTAGATTAA