Details for Chinese cabbage Locus Brara.A03450

Position : A01 ( 5`- 28303042 .. 28305914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03450

Protein [Map View]
MGKPEDDGNSLRAGGEALGDSAERRRRNAPPRCCCGCFEWISGLVGCKCLFVLLLSVSLFLSALFLLLPFGAVDRGGSSL
DPRFKGHAVVASFSLNRPKSFLNEHLTQLQQDIFQEMSYISINVTILALESHELNTTKVVFGIDHDTAYREIFPLSLSTI
KGMFESVLINQSTLQLTKPLFGDTFLFEVLKFPGGITVIPPQSAFPLQKFKLSFNFTLNYSIHRIQINFNTLAIQLKNGL
NLAPYENLYVTLSNAEGSTVYPPTTVHSSVLLRVGTSNPSPRLKQLTDTITGSRSKNLGLNNTIFGKVKQVRLSSLPNNS
DSSTNSPSPSPSPHSNHHHHHHHHHHHHNHHHHHHHHNHHHQLSPSIAPAISPVASPVPQKSPRSRRAPSAPPPCNSGNR
RGQRVHFKDKHLHFSSTPTPTPSPSPASHRPPRFSAQPPHASHQSPRYSARPPHHQLHSPAPIPAAKPHIVPVSAPLPHV
VFANAAPPPKTKPSEPQHANDVAHPQPQTSSSNLNLLATPWIVLLMLIAAWLRE*

DNA
ATGGGTAAACCTGAGGATGACGGCAACAGCCTCCGCGCCGGAGGAGAAGCTCTCGGCGATTCCGCGGAGAGGAGGAGGAG
GAATGCTCCTCCTCGTTGTTGTTGTGGGTGTTTCGAATGGATCTCGGGGCTTGTTGGGTGTAAATGCCTCTTCGTGCTGC
TTCTCTCCGTCTCCTTGTTTCTCTCCGCTTTGTTTTTGTTGCTTCCTTTTGGCGCCGTGGATCGTGGGGGTTCGAGTCTC
GATCCCAGATTTAAAGGTCATGCTGTAGTAGCGAGTTTTAGCCTCAATAGACCAAAATCTTTTCTTAATGAACATCTCAC
GCAGCTTCAACAAGACATCTTCCAAGAGATGAGCTACATTTCCATCAACGTAACTATCCTAGCCCTCGAGTCACACGAAC
TGAACACGACAAAGGTTGTGTTTGGAATCGACCACGATACAGCATACCGAGAAATATTTCCTCTCTCCTTGAGTACTATC
AAGGGGATGTTCGAGTCGGTGCTGATAAACCAATCCACTCTTCAGCTTACCAAACCCTTGTTTGGGGACACTTTCCTTTT
CGAAGTTCTAAAGTTTCCGGGAGGAATCACTGTGATTCCACCTCAAAGTGCGTTCCCGCTGCAGAAGTTCAAGCTTTCTT
TCAACTTTACGCTAAACTACTCCATTCATCGGATCCAGATAAACTTCAATACCCTTGCTATTCAACTCAAGAATGGCCTG
AATCTCGCACCATACGAGAATTTGTATGTAACCTTATCAAACGCAGAGGGTTCCACCGTGTATCCCCCTACGACTGTTCA
CTCATCTGTTTTGCTGAGAGTCGGGACTTCAAATCCAAGCCCGAGATTGAAGCAGCTGACTGATACCATCACGGGCTCAC
GCTCGAAGAACCTTGGCCTGAACAATACCATATTTGGTAAGGTCAAGCAAGTTCGTCTGTCATCTTTGCCAAACAACAGT
GATAGCAGCACCAACTCTCCATCACCTTCACCTTCCCCTCATTCCAACCACCACCATCACCACCATCACCATCATCATCA
CCACAACCATCATCACCACCACCACCACCACAACCATCATCACCAGCTTAGCCCAAGTATAGCTCCTGCTATTTCACCTG
TGGCCTCTCCTGTCCCTCAGAAAAGTCCTAGAAGTAGAAGAGCTCCATCTGCACCTCCGCCCTGCAACTCAGGGAATAGA
AGAGGACAAAGAGTACATTTCAAGGATAAACATTTGCATTTCTCATCTACACCTACTCCCACGCCTTCCCCTTCCCCTGC
ATCGCATCGTCCTCCTCGCTTTTCTGCTCAGCCACCACATGCATCACATCAGTCTCCTCGCTATTCTGCTCGACCACCAC
ATCATCAGCTGCACTCACCGGCCCCTATTCCTGCAGCCAAGCCTCATATAGTTCCAGTCTCTGCCCCTCTACCTCATGTG
GTGTTTGCCAATGCAGCTCCACCACCGAAAACCAAACCAAGTGAACCGCAGCACGCAAACGATGTTGCTCATCCTCAACC
GCAGACATCTTCATCTAATTTGAACTTACTAGCTACGCCATGGATTGTCCTACTCATGCTGATAGCGGCTTGGCTTCGTG
AATAA