Details for Chinese cabbage Locus Brara.A03449

Position : A01 ( 5`- 28301625 .. 28302355 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03449

Protein [Map View]
MGKQPVKLKAVVYALSPFQQKIMTGLWKDLPEKIHHKVSENWISATLLVTPVLGTYWYAQHFQEQEKLEHRF*

DNA
ATGGGGAAGCAGCCGGTGAAGCTGAAGGCGGTGGTCTACGCGCTGTCGCCGTTTCAGCAGAAGATAATGACGGGACTCTG
GAAGGATCTCCCGGAGAAGATCCACCACAAGGTCTCTGAGAATTGGATCAGCGCCACTCTCCTCGTCACTCCTGTCCTCG
GAACCTACTGGTATGCTCAGCACTTCCAGGAACAGGAGAAACTGGAGCACAGGTTCTGA