Details for Chinese cabbage Locus Brara.A03446

Position : A01 ( 5`- 28288460 .. 28289596 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03446

Protein [Map View]
MARVLLEPQANAPADANPKARTGFNDTYFDTNMVIILAALLCALICALSLNSALRCVLRITSRFTPEQDAAASNANANPG
RLTATTGLKKRALKQIPVGLYGSGIINMKATECLICLGDFVEGEKVRVLPKCNHGFHVRCIDTWLLSRDSCPTCRQSLIL
EQPSPMGGSSRRDDDVAVSVVGT*

DNA
ATGGCTCGGGTGTTACTTGAGCCGCAAGCAAACGCACCGGCCGACGCAAACCCTAAAGCCAGAACAGGCTTTAACGACAC
CTACTTCGACACTAACATGGTCATTATCTTAGCTGCTCTACTCTGTGCTCTGATATGTGCTCTAAGCCTCAACTCTGCTT
TGCGATGTGTGCTACGCATCACAAGCAGATTCACACCGGAGCAAGACGCAGCCGCTTCAAACGCAAACGCAAATCCTGGA
CGTTTAACGGCTACCACGGGGCTCAAGAAACGGGCGCTGAAGCAAATCCCCGTGGGATTGTACGGATCAGGGATCATTAA
CATGAAAGCTACGGAGTGTTTGATCTGTCTCGGGGATTTCGTGGAAGGAGAGAAAGTTAGGGTTTTGCCAAAATGTAACC
ATGGCTTTCACGTGAGGTGCATCGACACTTGGTTGCTTTCACGTGACTCTTGTCCCACTTGCAGACAATCTCTTATCCTT
GAGCAACCGTCGCCGATGGGTGGTAGTTCTCGCCGGGATGATGACGTGGCAGTTTCTGTCGTAGGGACATAA