Details for Chinese cabbage Locus Brara.A03439

Position : A01 ( 5`- 28238199 .. 28249776 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03439

Protein [Map View]
MPSQKLSIQETRQELDTLADSETKNRAVVLKLYDALRSRDAESVHRILTPDLDYWFHGPPPHQFLMRTLTGVSPPFEFAP
LSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGIITQVREYSNTSLTVTRIGGVVAGLSAEIARSHCPSVWESKFSGRAGK
SVPGLVLAI*

DNA
ATGCCCAGCCAGAAGCTTTCGATTCAAGAAACTCGCCAAGAACTGGATACTCTGGCGGATTCAGAGACCAAGAACCGAGC
CGTGGTTCTGAAACTGTATGACGCCCTGAGATCTCGCGACGCCGAGTCGGTTCACCGGATCCTCACCCCGGATCTCGACT
ACTGGTTCCACGGCCCTCCGCCGCACCAGTTTTTGATGCGCACGCTCACCGGCGTCTCTCCGCCCTTCGAATTCGCGCCT
CTCTCCGTCGTCTCCTTCGGATCAACCGTCATCGCCGAGGGCTGCGACGCCGCTAGCTCCGTCTCCTGGATCCACGCCTG
GACCGTGTCGCATGGGATAATCACTCAGGTGAGGGAGTACTCGAACACTTCTCTCACCGTCACGAGGATCGGTGGCGTCG
TCGCCGGACTGTCTGCTGAGATCGCGCGCTCGCATTGCCCCTCCGTGTGGGAAAGCAAATTCTCGGGTCGGGCTGGAAAG
TCCGTACCGGGTCTGGTTCTTGCGATTTGA