Details for Chinese cabbage Locus Brara.A03437

Position : A01 ( 5`- 28228040 .. 28230764 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03437

Protein [Map View]
MGAGRKTETYTLAPDSLNSYVNWCVRNLEKKDLCGVIFGCKFSTIKECYAKKLFGLPAPHMAYIKNIDPGLTLFLFNYSD
RTLHGIFEAASEGQLNIDPKAWSPNGTDPSPYPAQVKIRVRVKCEPLAEEKFSPVIAGNYQDEKMFWFELDRDQTNKLLR
MFSPSPYVRAPLTSKYAVASLSRKAIPASSLVEIGEVGATRVDKWSSLFKSSDDSGENKGEDSSGARGAGSRAVVNLGKA
EKAVVQSGVSYSSVLRNVTESSTSTNEVPSQASKGWSSSSRPFSSRQDSTKGTINMIGHSKDVSAEDTHSEIDWDAASNF
QAHLEGLERILEEPTGFASSSSMVPNHWEDGIPLSDYEEGNIDKSPCGSSYVSAMTGDAVDDNGYDKEKLRMDLSKMELG
SPPTYVDILSEIWAEVKELKQTQMKQAEYMITLQMELLESRKEILQLKRT*

DNA
ATGGGTGCAGGGAGGAAGACGGAGACGTATACGCTGGCTCCAGATAGCCTTAACTCATATGTGAATTGGTGCGTGAGGAA
TCTTGAGAAGAAAGATCTCTGTGGAGTTATATTTGGATGCAAGTTCAGCACTATCAAAGAGTGTTACGCTAAGAAGTTGT
TTGGTTTGCCAGCTCCTCACATGGCGTATATCAAGAACATTGATCCTGGTTTGACGCTGTTTCTGTTTAACTACAGTGAT
AGAACACTTCATGGTATCTTTGAAGCTGCTAGTGAAGGACAGTTGAACATTGATCCCAAAGCTTGGTCTCCTAATGGGAC
TGATCCAAGTCCTTACCCTGCTCAGGTAAAGATAAGAGTCAGAGTGAAGTGTGAGCCTTTGGCTGAAGAAAAGTTTAGTC
CAGTGATTGCTGGCAATTACCAGGATGAGAAGATGTTTTGGTTTGAGCTTGACCGAGATCAGACAAACAAGCTGCTCCGT
ATGTTTTCACCGTCGCCGTATGTAAGGGCACCGTTAACATCCAAATATGCTGTTGCATCACTATCCAGGAAGGCTATTCC
GGCGTCTTCTCTTGTGGAGATAGGCGAGGTAGGAGCAACACGGGTTGATAAGTGGAGCAGTCTTTTCAAGTCTTCAGACG
ATTCAGGTGAGAACAAAGGAGAAGACTCAAGTGGAGCACGCGGGGCAGGGTCAAGAGCAGTAGTCAACCTTGGAAAAGCT
GAGAAAGCAGTGGTGCAATCTGGTGTTTCTTACTCATCAGTTCTGAGAAACGTGACCGAGTCTTCGACTTCAACAAATGA
AGTTCCATCACAAGCAAGTAAAGGATGGTCATCTTCTTCTCGACCTTTCTCCTCACGCCAAGACAGTACCAAGGGAACTA
TTAACATGATAGGACATAGCAAGGACGTTTCTGCTGAGGACACACATTCGGAGATCGATTGGGATGCTGCATCGAATTTC
CAAGCACATCTTGAAGGACTGGAGAGGATTTTAGAAGAACCTACAGGATTTGCATCGTCGTCTTCTATGGTGCCCAATCA
TTGGGAAGATGGGATACCGCTCTCGGACTATGAGGAAGGGAACATAGATAAATCTCCTTGTGGGTCCTCTTATGTTTCCG
CCATGACAGGAGACGCTGTTGATGACAACGGATATGACAAAGAGAAGCTTCGTATGGATCTTTCCAAGATGGAATTGGGA
TCCCCACCCACTTACGTGGATATCTTGAGTGAGATATGGGCGGAAGTAAAGGAGTTAAAGCAAACTCAGATGAAGCAAGC
TGAGTATATGATTACTTTGCAGATGGAGCTGCTTGAATCAAGAAAAGAGATACTTCAACTGAAAAGGACATAG