Details for Chinese cabbage Locus Brara.A03436

Position : A01 ( 5`- 28226749 .. 28228010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03436

Protein [Map View]
MAIYEQTGINTSSKKRKSRARADGTTVADRLKKWKEYNVIADASSTKKRKVPAKGSKKGCMKGKGGPENTHCSFRGVRQR
VWGKWVAEIREPNRVSRLWLGTFPTAEEAASAYDEAAKVMYGPLARLNFPQQCVVASEFLASTSSQSEVCSVEVKPVLVG
DVHCESRPVSQISDGNTRMSSDLLNEFDEEYWGRVAKEIEKPKEGEEEVLTVADYGWSNDMLSEQDLWDPNEVFDVDELL
GDIDECIMLTGTGPDEDQNQINPGGYDSHIPLQLEPHDGHEFFDLSSQDL*

DNA
ATGGCAATTTATGAACAAACCGGAATCAATACATCATCAAAGAAGAGAAAATCAAGAGCTCGAGCAGACGGTACAACGGT
GGCTGATAGGCTAAAGAAGTGGAAAGAGTACAACGTGATCGCTGATGCATCCTCTACTAAAAAACGGAAAGTTCCTGCGA
AAGGATCGAAGAAAGGGTGTATGAAAGGCAAAGGAGGACCTGAGAACACTCACTGTAGTTTCAGAGGAGTTAGACAAAGA
GTTTGGGGTAAATGGGTTGCAGAGATCCGTGAACCTAACAGAGTGAGTAGGCTTTGGCTTGGTACTTTCCCTACAGCTGA
AGAAGCTGCTTCTGCTTATGATGAAGCCGCTAAGGTTATGTACGGTCCTTTGGCACGCCTTAACTTTCCTCAACAGTGTG
TTGTTGCCTCTGAGTTCTTGGCTAGTACATCGAGTCAGTCTGAGGTGTGTAGTGTTGAGGTTAAACCGGTTCTTGTTGGT
GATGTTCATTGTGAATCTAGACCAGTTAGTCAGATTAGTGATGGTAATACCAGGATGAGTTCAGATTTGCTGAATGAGTT
TGATGAGGAGTATTGGGGCAGAGTAGCCAAGGAGATTGAGAAACCTAAGGAGGGAGAGGAAGAAGTGCTTACCGTTGCGG
ATTATGGTTGGTCTAATGATATGTTGAGCGAGCAGGATCTCTGGGATCCGAATGAAGTTTTTGATGTTGATGAACTCCTA
GGCGATATAGATGAATGCATCATGTTAACAGGTACCGGTCCGGATGAAGACCAGAACCAGATAAATCCTGGTGGTTATGA
CTCGCATATTCCTCTTCAGCTGGAGCCACACGATGGTCACGAGTTCTTTGACTTGAGTTCTCAGGATCTTTGA