Details for Chinese cabbage Locus Brara.A03428

Position : A01 ( 5`- 28133427 .. 28136187 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03428

Protein [Map View]
MDVFVCFSHSLVTIPPHCWTNTAHRHGVKVLGTFITEWDEGKATCNEMLATKESAQMYAERLAELATSLGFDGWLINIEN
EIDKEQVPNLMEFVSHLTKVLHLSTPGSLVIWYDSVTVHGHLKWQDHLNEKNKPFFDLCDGIFMNYTWKESYPKLSAEVA
GGRKYDVYMGIDVFGRGSFGGGQWTVNTALDLLKRNNVSAAIFAPGWVYETAQPPNFHIAQNKWWSLVEKSWGVVQTYPQ
VLPFYSDFNQGFGYHVSLEGRQLSDAPWYNISCQSLQPLLEFKEDNTDIIQVNFDAREASYNGGGNIVFKGRLEGDLYFT
ARLFKPLLHLSSSPITVSYSVKSDETSKLGLLLGFSSPSHQTKSILVAPQEPTPRLDHMFLKCLVTSEQTVSEWTVHEAS
LVMDGHTLTEISAFCYKTENSTKTSEYVALLGHISIKEHAQLQQNLVSLPPASSWVIEAHSIELVPGDSGSKILKVKLEW
RQTQLEDSVLPVYNVYAESVKSTDVLRSRKVLEKPRSERVFLGVSHVPAYYVSELVVDSDVKGVSFVVQPCGEDGSWSKL
DVSPKHLVEREGLS*

DNA
ATGGATGTGTTCGTTTGCTTCTCACATTCTCTGGTGACGATTCCTCCTCATTGTTGGACCAATACAGCTCATAGGCATGG
TGTTAAGGTGTTGGGGACTTTCATCACGGAATGGGATGAAGGAAAAGCTACCTGCAATGAGATGCTTGCTACTAAAGAGT
CTGCTCAGATGTATGCAGAGCGTTTGGCTGAGCTTGCTACTTCTCTAGGTTTCGATGGATGGCTGATAAATATAGAGAAC
GAAATAGATAAAGAACAGGTTCCTAATTTGATGGAGTTCGTCAGCCATCTAACAAAAGTATTGCATTTATCTACGCCTGG
GTCTCTGGTTATATGGTACGATAGTGTCACTGTTCATGGCCATCTTAAATGGCAAGATCATTTGAATGAGAAGAACAAAC
CTTTCTTTGACTTGTGTGATGGAATCTTCATGAACTATACATGGAAGGAGAGCTACCCAAAACTATCAGCTGAAGTTGCA
GGTGGCAGAAAATATGATGTTTACATGGGAATTGATGTCTTTGGTCGCGGCTCCTTTGGTGGTGGGCAATGGACTGTTAA
TACTGCTCTTGATTTGCTGAAGAGAAACAATGTATCAGCTGCCATTTTCGCTCCTGGATGGGTATATGAGACTGCACAAC
CTCCTAATTTTCATATAGCTCAGAATAAATGGTGGTCACTTGTTGAGAAGTCATGGGGAGTAGTCCAAACATATCCACAA
GTCTTGCCTTTTTACTCTGACTTCAATCAGGGCTTTGGTTACCATGTTTCGCTCGAGGGTCGCCAGTTATCTGATGCTCC
ATGGTACAACATTTCTTGCCAAAGTCTTCAGCCACTCCTAGAGTTCAAGGAAGACAACACTGATATCATCCAGGTCAATT
TTGATGCTCGAGAGGCATCTTATAACGGAGGAGGGAACATTGTATTTAAAGGAAGACTCGAGGGAGATTTGTATTTCACA
GCAAGGCTCTTTAAACCTCTTCTTCACCTTTCTTCTTCCCCCATCACAGTCTCCTACTCTGTGAAATCAGATGAGACTTC
TAAACTTGGACTCCTGCTTGGGTTTTCATCACCATCGCACCAAACTAAATCCATACTCGTGGCGCCACAAGAACCAACCC
CAAGATTAGATCACATGTTCTTGAAGTGCCTCGTTACATCAGAGCAGACTGTATCAGAGTGGACGGTGCACGAGGCAAGC
CTTGTCATGGATGGACACACACTGACTGAAATCTCTGCCTTTTGCTACAAAACAGAGAACTCGACGAAGACATCAGAGTA
CGTTGCATTGCTGGGTCACATCTCAATCAAAGAACATGCTCAGCTCCAGCAAAACCTCGTTTCCTTACCTCCAGCGTCAT
CATGGGTCATCGAGGCTCATAGCATAGAGCTTGTACCGGGTGATTCCGGTTCTAAGATCCTTAAGGTTAAGCTAGAATGG
AGACAGACACAGCTTGAAGACTCTGTTCTCCCAGTGTACAATGTGTATGCAGAGAGTGTGAAGTCAACTGATGTACTAAG
ATCGAGGAAGGTTTTGGAGAAACCAAGAAGCGAGAGAGTGTTCCTAGGAGTGTCTCACGTACCAGCCTATTACGTTTCGG
AGCTGGTGGTAGATTCTGACGTGAAAGGAGTCAGCTTCGTGGTTCAACCGTGTGGTGAAGATGGTTCATGGAGTAAGCTG
GATGTTTCCCCTAAACATCTTGTTGAACGAGAAGGTCTCTCGTAG