Details for Chinese cabbage Locus Brara.A03423

Position : A01 ( 5`- 28103460 .. 28104803 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03423

Protein [Map View]
METTPETQSKPHPHRLPPGREDWWSEDATATLIEAWGDRYVNLSRGNLRQNDWKEVADAVNSIHGGSGRPKTDVQCKNRI
DTLKKKYKTEKAKPSPSSWCFFERLNFLIGPVAAKKSTGVVTPALKNHTLNQTGSKSSGSSLDDDDEDEEDDDEVGDWGF
VVRKHRRVGEVDPSGGEGSSCRELARAILKLGEVYERMEGAKQRMMVELEKQRMEAAKELELQRMNMLMDMQMELERSKL
GKRRAASSGKKL*

DNA
ATGGAGACGACGCCGGAGACTCAATCAAAACCCCATCCCCACCGTCTTCCGCCGGGGCGAGAGGACTGGTGGAGCGAGGA
CGCGACGGCGACGCTGATAGAAGCCTGGGGAGACCGTTACGTCAACCTCAGCCGCGGAAACCTCCGGCAGAACGACTGGA
AGGAAGTCGCCGACGCCGTGAACTCGATCCACGGCGGCAGCGGGAGGCCGAAGACGGACGTGCAGTGCAAGAACCGGATC
GACACGCTGAAGAAGAAGTACAAGACGGAGAAGGCGAAGCCTTCTCCGTCGTCTTGGTGCTTCTTCGAGAGGCTCAACTT
CTTGATCGGTCCCGTCGCGGCGAAGAAATCTACCGGAGTTGTGACACCGGCGTTAAAGAATCATACTTTGAATCAAACCG
GATCTAAATCGAGTGGGAGCTCTCTGGACGATGATGATGAGGATGAGGAGGATGATGATGAGGTGGGAGATTGGGGGTTT
GTGGTGAGGAAGCATCGGAGAGTGGGGGAGGTGGATCCGAGTGGAGGGGAAGGTTCGTCGTGTAGGGAGCTGGCGAGGGC
GATTTTGAAGTTGGGGGAGGTGTACGAGAGGATGGAAGGTGCGAAGCAGAGGATGATGGTTGAGTTGGAGAAGCAGAGGA
TGGAAGCTGCAAAGGAGCTTGAGTTGCAACGGATGAACATGTTGATGGATATGCAGATGGAGCTTGAAAGATCCAAGCTT
GGCAAGCGTAGAGCTGCTTCTTCAGGGAAGAAGTTGTAG