Details for Chinese cabbage Locus Brara.A03422

Position : A01 ( 5`- 28094184 .. 28103044 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03422

Protein [Map View]
MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTHDHLQIFNIEAKAKLKSHQMPEQVAFWKWITPKMLGLVTQTSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPDEKWLVLIGIAPGSPERPQLVKGNMQLFSVNQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFSKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYMFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY
NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDSCIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDTHVHNALGK
IIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARYVVERMDGDLWDKVLV
EENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVM
DYINRLDNFDGPAVGEVAVDAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDSVWSQVAKAQLRDGLV
SDAIESFIRAEDATHFLEVIRATEDANVYDDLVRYLLMVRQKVKEPKVDSELIYAYAKIDRLGEIEEFILMPNVANLQTV
GDRLYDEALYEAAKIIYAFISNWAKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEFRLAQICGLNVIIQVD
DLEEVSEFYQNRGCFSELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIPKLIRACDEQQHWQEL
TYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVLALRLDHTRVVDIMRK
AGQLRLIKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVEMRRVAAYIYKKAGRW
KQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELAWINNMIDFAFPYLLQ
FIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGPGMGGGYGPPPQMGGMPGMPP
MPPYGMPPMGGY*

DNA
ATGGCGGCAGCAAACGCCCCAATCACGATGAAGGAGGTCCTAACGCTTCCGAGCATTGGGATCAACCAGCAATTCATCAC
GTTTACGAATGTTACTATGGAGTCTGACAAGTACATATGTGTACGAGAGACTGCACCTCAGAACAGCGTCGTGATTATAG
ATATGAACATGCCGATGCAGCCTCTAAGGAGACCTATAACTGCTGATTCTGCTCTTATGAACCCAAACTCCAGGATCCTT
GCCTTGAAAGCTCAAGTTCCAGGAACTACTCACGATCATCTTCAGATATTTAACATCGAAGCAAAAGCGAAGTTGAAATC
ACATCAGATGCCTGAGCAGGTTGCTTTTTGGAAATGGATTACACCAAAGATGTTGGGGCTGGTCACACAAACTTCCGTGT
ATCATTGGTCGATTGAAGGTGATTCTGAGCCAGTTAAGATGTTTGATAGAACTGCCAATTTGGCAAACAATCAAATTATT
AACTATAAGTGCTCTCCTGATGAGAAGTGGTTGGTGTTGATTGGAATTGCTCCTGGCTCTCCTGAGAGGCCACAATTGGT
AAAAGGGAATATGCAGCTATTCTCTGTAAATCAACAGCGGAGCCAGGCCCTTGAGGCGCATGCTGCTTCATTTGCTCAGT
TTAAGGTCCCTGGGAATGAGAATCCTTCTATTCTTATATCCTTTGCAAGCAAGAGCTTTAATGCTGGGCAGATAACATCA
AAGTTGCATGTCATTGAGCTTGGTGCACAACCAGGAAAACCATCATTTTCAAAGAAGCAGGCAGATCTCTTTTTCCCTCC
TGATTTTGCAGATGACTTTCCTGTAGCCATGCAGGTCTCACACAAATTTAACTTGATATATGTCATCACCAAGCTTGGCC
TGTTGTTTGTATACGATCTAGAGACGGCTTCTGCTATCTACAGAAATCGGATAAGTCCAGACCCAATTTTCTTGACTTCT
GAAGCTTCTTCCGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCTACAGTAAACGAGGCTACGAT
AATACCGTTTATTAGCGGTCAATTGAACAATTTGGAACTTGCTGTCAATCTGGCTAAAAGAGGAAACCTCCCTGGTGCGG
AAAATCTGGTTGTCCAGCGGTTCCAAGAGTTATTTGCTCAAACAAAGTACAAGGAGGCTGCTGAACTTGCTGCTGAATCT
CCTCAGGGGATTCTACGGACACCTGATACGGTGGCTAAGTTCCAGAGTGTTCCTGTACAAGCAGGGCAAACTCCTCCCTT
GTTACAGTATTTTGGAACCCTTTTGACTAGAGGGAAGCTCAATTCATATGAGTCTTTGGAACTATCCCGACTTGTTGTGA
ATCAAAACAAGAAGAACCTTTTGGAAAACTGGTTGGCAGAGGATAAGTTAGAATGCAGTGAAGAACTTGGAGACCTTGTC
AAGACTGTGGATAATGACCTGGCTCTGAAAATATACATCAAAGCTCGAGCTACTCCAAAAGTCGTAGCAGCTTTTGCAGA
GCGAAGGGAGTTTGACAAAATATTGATTTACTCAAAGCAGGTTGGGTACACGCCTGATTACATGTTTCTTCTGCAAACAA
TACTCCGTACGGATCCTCAGGGAGCAGTAAATTTCGCTTTAATGATGTCCCAAATGGAAGGAGGTTGTCCAGTTGACTAC
AATACCATAACTGATCTTTTCCTTCAGAGAAATCTGATCCGTGAAGCGACTGCTTTCCTTTTGGATGTTCTGAAGCCAAA
TTTACCTGAGCATGCTTTTCTACAAACTAAGGTTTTGGAGATCAATTTGGTAACCTTTCCCAATGTGGCTGATGCAATTT
TAGCAAATGGGATGTTCAGCCACTATGACCGCCCTCGGGTTGCTCAGCTTTGTGAAAAGGCTGGACTTTATATCCAATCT
TTAAAGCATTACTCAGAGTTACCTGATATTAAACGTGTAATTGTGAACACACATGCAATTGAGCCGCAGGCTCTTGTCGA
GTTTTTTGGTACTCTTTCCAGCGAGTGGGCTATGGAGTGCATGAAGGATCTTCTGTTGGTTAACCTGAGAGGCAACCTTC
AGATAATCGTTCAGGCTTGCAAGGAGTACTGTGAGCAACTTGGTGTTGATTCATGCATCAAACTCTTTGAGCAGTTCAAG
TCGTATGAAGGACTATACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCCGAGATTCACTTCAAGTACATTGA
AGCAGCTGCCAAGACTGGTCAAATAAAGGAGGTTGAGCGTGTCACTAGAGAGTCTAACTTTTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTTCCTGATGCCCGGCCATTGATAAATGTCTGCGACCGTTTTGGCTTTGTACCTGAT
CTGACCCATTACCTGTACACAAACAACATGCTTCGTTACATTGAAGGTTACTTGCTTGATGACGAATGCCCTGAAGATTT
TATAAAAGGCCTCATTCTCTCTGTTCGTTCATTGCTTCCAGTCGAACCCCTTGTTGAGGAATGTGAGAAGAGAAATCGAC
TCCGTCTCCTTACTCAGTTCTTGGAGCATCTAGTTAGTGAGGGAAGCCAAGATACGCATGTCCACAATGCCTTGGGTAAA
ATTATCATAGACAGCAACAACAACCCTGAGCATTTCCTAACCACCAACCCGTACTATGACTCTAAGGTTGTGGGTAAGTA
CTGCGAGAAACGTGATCCCACCCTGGCTGTTGTGGCATACAGAAGAGGACAATGTGATGAAGAACTCATCAATGTCACCA
ACAAAAACTCTTTGTTCAAGTTACAAGCCAGGTACGTAGTGGAGAGGATGGATGGTGACCTCTGGGACAAGGTTCTTGTG
GAGGAAAATGAATATAGAAGACAACTTATTGACCAAGTTGTGTCTACTGCTTTACCCGAAAGCAAGAGCCCAGAGCAAGT
CTCTGCAGCTGTTAAAGCATTCATGACTGCTGATCTCCCGCATGAGCTTATCGAACTTCTGGAAAAGATTGTGCTTCAAA
ACTCGGCCTTCAGTGGAAACTTCAATCTGCAAAATCTGCTTATACTGACAGCAATCAAGGCAGATCCGTCTAGAGTTATG
GATTACATTAACAGGCTAGATAATTTTGATGGTCCGGCTGTTGGAGAAGTTGCGGTTGATGCCCAATTATATGAGGAAGC
ATTTGCGATTTTTAAGAAGTTTAACTTAAATGTTCAAGCTGTCAACGTATTGTTGGATAACGTCAGAAGCATTGAGCGTG
CCGTTGAGTTTGCTTTCCGGGTTGAAGAGGATTCTGTTTGGAGCCAAGTCGCTAAGGCTCAGCTTAGAGATGGACTAGTC
AGTGATGCAATTGAGTCATTTATCCGTGCCGAGGATGCCACTCATTTCTTGGAGGTCATACGTGCTACTGAAGATGCTAA
TGTCTATGATGACTTGGTCAGATACCTTCTTATGGTTAGACAGAAGGTGAAAGAACCCAAGGTTGATAGTGAGCTCATCT
ATGCTTATGCAAAGATTGATAGGTTGGGTGAGATTGAAGAATTTATTCTGATGCCAAACGTTGCTAACCTACAAACTGTC
GGTGATCGCCTGTATGACGAAGCGCTGTACGAGGCTGCAAAAATAATTTATGCGTTCATTTCAAACTGGGCCAAGTTAGC
CGTCACACTTGTGAAGTTGCAGCAGTTCCAAGGTGCTGTTGATGCTGCAAGGAAAGCAAACAGTGCAAAGACATGGAAGG
AAGTCTGCTTTGCTTGTGTTGATGCAGAGGAATTCCGGTTGGCTCAAATATGTGGACTTAACGTTATTATTCAGGTGGAT
GACCTGGAAGAAGTTAGCGAGTTCTACCAGAACAGAGGATGCTTCAGCGAATTAATCTCACTTATGGAGAGTGGACTTGG
TCTGGAACGGGCTCACATGGGGATCTTCACCGAGTTGGGTGTACTGTACGCCAGATATCGTTATGAGAAGCTTATGGAAC
ACATCAAGTTGTTCTCGACTCGACTCAATATTCCCAAGCTTATACGAGCCTGTGATGAACAACAGCACTGGCAGGAACTT
ACCTATCTTTACATTCAGTATGATGAGTTTGATAATGCTGCTACCACTGTCATGAACCACTCTCCTGAAGCATGGGAGCA
CATGCAATTCAAAGACATTGTTGCCAAGGTTGCGAATGTTGAGCTTTACTACAAGGCCGTTCACTTCTACTTGCAAGAGC
ACCCTGATATAATCAACGATCTTCTCAATGTGCTTGCTCTGCGGTTAGATCACACACGTGTCGTGGATATTATGCGCAAG
GCTGGTCAGTTGCGCCTTATAAAGCCCTACATGGTTGCAGTTCAGAGCAACAATGTTTCTGCTGTAAATGAAGCTCTGAA
TGAGATATACGTAGAAGAAGAAGACTATGACAGGTTACGCGAGTCTATCGATTTGCATGACAGCTTTGATCAGATAGGCC
TCGCTCAGAAGATTGAGAAACACGAGCTTGTTGAAATGAGGCGTGTGGCTGCGTATATCTACAAGAAAGCTGGTAGATGG
AAGCAATCAATCGCATTGTCGAAGAAAGATAACATGTACAAGGACTGTATGGAAACTGCTTCACAATCCGGCGACCATGA
CCTTGCAGAACAACTTCTGGTTTACTTCATTGAACAGGGGAAGAAGGAATGCTTTGCCACATGTCTCTTCGTGTGTTATG
ACTTAATCAGACCAGATGTTGCTCTAGAACTTGCTTGGATCAACAACATGATTGACTTTGCCTTCCCGTATCTCCTCCAG
TTTATCCGAGAATACTCTGGGAAAGTGGACGAACTAATCAAGGACAAGCTAGAAGCACAGAAAGAAGTGAAGGCCAAAGA
GCAGGAAGAGAAGGATGTCATGTCCCAACAGAACATGTACGCGCAACTATTGCCACTGGCTCTACCTGCGCCACCGATGC
CAGGAATGGGAGGAGGTCCAGGGATGGGAGGCGGTTATGGTCCGCCACCACAGATGGGAGGAATGCCAGGAATGCCTCCA
ATGCCGCCATATGGAATGCCTCCGATGGGCGGGTACTAA