Details for Chinese cabbage Locus Brara.A03419

Position : A01 ( 5`- 28076929 .. 28079446 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03419

Protein [Map View]
MAAAVSSNPRTVEEIFKDYTSRRAALLRALTKDVDGFYSQCDPEKENLCLYGHPNESWEVNLPAEEVPPELPEPALGINF
ARDGMQRKDWLSLVAVHSDCWLLSVSFYFGARLNRNERKRLFSLINDLPTLFDVVTGRKPIKDNKPSSDSGSKSRNGGTK
RSIEGQPKSTTPKLMEERYEEEEDEEEEDEHGDTLCGSCGGNYTQDEFWIGCDVCERWYHGKCVKITPAKADSIKQYKCP
PCCAKKGGRQ*

DNA
ATGGCCGCCGCCGTCTCCTCTAACCCTCGCACCGTCGAAGAGATCTTCAAAGACTACACCTCTCGCCGCGCCGCTCTTCT
TCGCGCTCTAACCAAAGATGTTGATGGTTTTTACTCTCAATGCGATCCGGAGAAGGAGAATTTGTGTTTGTATGGACATC
CGAATGAGTCGTGGGAAGTGAATCTACCGGCGGAGGAAGTTCCGCCGGAGCTACCTGAGCCAGCGCTTGGTATCAATTTC
GCTAGAGATGGTATGCAGAGGAAAGATTGGCTCTCTCTCGTTGCTGTTCATAGTGATTGTTGGTTGCTATCTGTTTCTTT
CTACTTTGGTGCTCGCCTTAACCGCAACGAGAGGAAGCGGCTATTCAGTCTGATCAACGATCTCCCAACTCTCTTTGATG
TAGTGACTGGTAGGAAACCCATCAAAGACAATAAACCAAGCTCAGACTCCGGAAGCAAATCCAGAAACGGTGGCACTAAG
AGATCAATAGAAGGGCAGCCAAAGAGCACAACACCAAAACTGATGGAAGAGAGGTACGAAGAGGAGGAGGATGAAGAGGA
AGAAGACGAACATGGAGACACTCTCTGCGGAAGCTGTGGAGGCAATTACACACAAGATGAGTTCTGGATTGGCTGTGATG
TTTGTGAGCGTTGGTACCATGGAAAATGCGTGAAGATCACTCCCGCCAAAGCAGACAGCATCAAGCAGTATAAATGCCCT
CCTTGCTGTGCAAAGAAAGGAGGAAGACAGTGA