Details for Chinese cabbage Locus Brara.A03418

Position : A01 ( 5`- 28073601 .. 28076265 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03418

Protein [Map View]
MVGPSRPQIVLFGSSIVQMSFGHGPALGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDALVQPSLVVVYF
GGNDSMGPHPSGLGPHVPLTEYVDNMKKIALHLQSLSESTRIIFLSCPPVDEAKVRQNQSPYLSEVIRTNELCKTYSDAC
VELCKELDLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSKLVAAEILRVVKEAEWRPSLHWKSMPTEFSEDSPYDLVAA
DGKTTLNSSEWTYFWEEQWE*

DNA
ATGGTTGGACCGTCGCGGCCTCAGATCGTTCTTTTTGGATCATCCATCGTCCAGATGAGCTTTGGTCATGGTCCGGCTCT
GGGTGGCTGGGGTGCTATTCTCTCCGAGGTCTATGCTCGCAAGGCAGACATCATTCTGCGGGGATATTATGGATGGAACT
CAACTCGTGCTTTGGAGGTTGTTGACAAAGTGTTCCCCAAGGATGCCTTGGTACAACCGTCTCTTGTAGTTGTCTATTTT
GGGGGAAACGACTCAATGGGACCTCATCCTTCTGGTCTAGGACCTCACGTGCCACTAACTGAATATGTTGATAACATGAA
GAAGATCGCTCTTCATCTTCAGAGCCTTTCAGAGTCAACTCGTATCATATTTCTAAGTTGCCCTCCAGTGGACGAAGCCA
AAGTTCGTCAAAACCAGAGCCCATACTTGAGCGAGGTAATCCGCACAAACGAGCTATGCAAGACATATTCAGACGCTTGT
GTAGAGCTATGCAAAGAGCTCGACTTACAAGTAGTGGATCTCTTCTCTACTCTTCAGAAAGCAGATGACTGGGAAACCGT
TTGCTTCACAGATGGGATTCATTTGTCAGCACAAGGAAGCAAACTGGTGGCTGCAGAGATACTGAGAGTGGTTAAAGAAG
CGGAGTGGAGACCGTCGCTTCACTGGAAATCGATGCCGACAGAGTTCTCTGAGGACTCTCCTTATGATCTTGTTGCAGCA
GATGGCAAAACGACGTTGAACTCTTCGGAGTGGACGTACTTCTGGGAAGAACAATGGGAGTAA