Details for Chinese cabbage Locus Brara.A03415

Position : A01 ( 5`- 28060188 .. 28061867 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03415

Protein [Map View]
METLHPLSHVPISENRFVVQEMMSSSSVWTKEENKMFERALAIYAEDSPDRWFSIASMIPGKTVFDVMKQYSKLEEDVSD
IEAGRIPIPGYPSASSPLGFDQDTCRKRPSWGRGSDHDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQ
VASHAQKYYQRQLSGAKDKRRPSIHDFTTVNLLNANLNRSFSDHRDILPDLGFIDKDDAEEGLMFLSQKHMFSPSSSPFD
AAVRFAGANVFSARS*

DNA
ATGGAGACTCTGCATCCCCTCTCTCACGTGCCTATCTCTGAGAACCGGTTCGTTGTTCAAGAGATGATGAGCTCGAGCAG
CGTCTGGACTAAAGAAGAGAACAAGATGTTCGAACGTGCCCTTGCGATATACGCTGAAGACTCGCCTGATCGCTGGTTCA
GTATCGCTTCTATGATCCCTGGTAAAACCGTTTTTGATGTTATGAAGCAATACAGTAAGCTTGAAGAAGACGTTTCCGAC
ATAGAAGCAGGACGTATCCCTATCCCTGGTTACCCTTCAGCTTCTTCTCCTTTAGGGTTTGACCAGGACACGTGTCGGAA
GCGACCTAGCTGGGGCAGAGGATCTGATCACGATCGAAAGAAAGGAGTCCCTTGGACAGAGGAAGAACACAGGAGATTCT
TGCTAGGGCTTCTCAAGTACGGGAAAGGAGATTGGAGAAACATATCGAGGAACTTCGTTGTGTCGAAGACACCGACGCAA
GTTGCGAGCCACGCTCAAAAGTACTACCAGAGACAACTCTCTGGAGCTAAGGATAAGCGCCGGCCAAGCATCCATGACTT
CACGACCGTTAATCTTCTGAACGCCAATCTTAACCGTTCCTTTTCTGATCATAGAGATATCCTCCCGGATTTAGGGTTTA
TCGACAAGGATGATGCCGAGGAGGGACTAATGTTTCTGAGTCAGAAACACATGTTTTCTCCATCATCCTCTCCCTTTGAT
GCTGCCGTCCGCTTTGCTGGAGCAAATGTATTCAGTGCCAGAAGTTAA