Details for Chinese cabbage Locus Brara.A03414

Position : A01 ( 5`- 28056379 .. 28059401 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03414

Protein [Map View]
MKGKAAWEPEYHRVFVELCVEQKLRGNKPGTQHLFEPFQERTGARFNKKQLKNHWDTMCKQWKIWRRLVQCSDMKWDPEA
NTFRATAEDWANYLQVNPDAGTFRSSPPLYLKKLEIIFEGSNVGDDEGGSSKCKRKRRSRHHHPEQEVDTGYDDDEHDMQ
IASNFSTHHDMKIESDFSTTHSKGYWSPATHELFLDLLVQETYKGNRPNTHYPKESWRLMLETINQNTGKKYTRPQLKNH
WDCTRKAWKIWCQLIGAPIMKWDPNTCTFGASEEDWRIYLEENPRATQFRRKQVPCADKLAIIFKGVIEPGKADFRPYRK
KLRDHSESPQLLHDPTPLSTLYINEPVTGSEDGDDDDDDEDADDDDDNDDYDGEPTHTPHRRRLGFAESRLQDVEIGTPV
YNSLEAKRMKESPLASAKQCEYTIGECIERLDSMEEVEPGSDLYMFALDLFLRKEYREIFLQLKKASLRISWLLRLQAGP
PTHAA*

DNA
ATGAAGGGGAAAGCTGCGTGGGAACCTGAATACCACAGAGTATTCGTGGAGCTATGCGTGGAGCAGAAGCTGCGAGGGAA
CAAACCTGGAACGCAGCATTTATTTGAACCTTTTCAGGAGAGGACAGGGGCGAGGTTTAACAAGAAGCAGCTTAAGAATC
ATTGGGACACAATGTGCAAGCAGTGGAAGATTTGGCGTAGGCTTGTTCAGTGCAGCGATATGAAGTGGGACCCTGAGGCT
AATACTTTCCGTGCCACTGCTGAAGACTGGGCCAACTATTTGCAGGTGAATCCTGATGCTGGTACGTTTCGGTCGAGTCC
TCCTTTGTATCTCAAGAAGCTAGAGATTATCTTTGAAGGCAGTAACGTAGGAGATGACGAAGGTGGTTCTAGTAAATGCA
AGAGGAAGAGAAGAAGCAGGCATCATCATCCTGAACAAGAAGTTGATACTGGATATGATGATGATGAGCACGATATGCAG
ATAGCGTCTAATTTCTCAACTCATCACGATATGAAGATTGAATCTGATTTCTCAACGACTCATTCAAAAGGGTACTGGTC
ACCAGCCACACACGAGCTGTTTCTTGATTTGTTGGTCCAAGAGACTTACAAAGGAAACAGACCTAACACACATTATCCAA
AGGAAAGCTGGAGACTGATGCTTGAGACGATTAATCAAAACACTGGGAAAAAGTACACAAGACCTCAGTTGAAAAACCAC
TGGGATTGTACTAGGAAGGCCTGGAAGATTTGGTGTCAACTCATTGGTGCTCCTATCATGAAATGGGATCCAAATACTTG
TACTTTCGGCGCATCAGAAGAGGATTGGAGAATCTATTTAGAGGAGAACCCTAGAGCTACACAGTTCAGAAGGAAACAAG
TTCCATGCGCTGACAAACTAGCAATCATCTTCAAAGGAGTTATTGAGCCTGGGAAAGCTGACTTCCGTCCTTACCGCAAG
AAACTACGAGACCATTCCGAGTCACCACAGCTGCTACATGACCCAACGCCACTATCAACTCTCTACATAAACGAGCCAGT
CACAGGAAGTGAAGATGGAGATGACGATGATGATGACGAAGATGCTGACGATGATGATGATAATGATGACTATGATGGTG
AGCCTACTCATACTCCTCATCGCAGGAGACTTGGTTTTGCAGAGTCTCGGTTACAAGATGTTGAGATTGGAACTCCGGTA
TATAACTCTTTGGAGGCTAAGAGGATGAAAGAGAGTCCGTTGGCTTCGGCCAAGCAATGCGAGTATACTATTGGTGAATG
TATTGAGCGTTTGGATTCGATGGAAGAGGTTGAGCCAGGGAGTGATCTTTACATGTTTGCGTTGGATTTGTTTCTGAGGA
AAGAGTACAGAGAGATCTTCTTGCAGTTGAAGAAAGCAAGTTTGAGAATCTCTTGGCTGCTTAGGCTTCAGGCTGGTCCT
CCTACTCATGCTGCTTAA