Details for Chinese cabbage Locus Brara.A03413

Position : A01 ( 5`- 28053449 .. 28054879 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03413

Protein [Map View]
MCVPATAARALKSVLQGILLSSEGEKLNSMNLLLYMAPIAVVFLLSATLIMEKNVVGITIALARDDFRIVWYLLFNSALA
YFVNLTNLLVTKHTSALTLQVLGNAKGAVAVVVSILIFKNPVSMTGMLGYSLTVCGVILYSEAKKRSK*

DNA
ATGTGCGTTCCAGCCACAGCTGCGAGAGCGCTTAAATCAGTTCTTCAAGGGATTTTGCTATCTTCTGAAGGGGAGAAGCT
AAACTCCATGAATCTCCTCCTGTACATGGCTCCCATTGCTGTTGTGTTCCTTCTTTCTGCTACACTCATCATGGAGAAGA
ACGTTGTTGGCATTACAATCGCACTAGCTAGAGACGATTTTAGAATCGTTTGGTATTTGCTTTTCAATTCTGCTCTCGCT
TATTTCGTGAACTTGACTAATTTATTAGTCACTAAACACACAAGCGCTCTGACTCTGCAGGTGCTAGGAAACGCCAAAGG
TGCAGTAGCAGTGGTGGTTTCGATTCTAATATTCAAGAATCCTGTCTCAATGACTGGAATGTTGGGCTACTCGCTCACGG
TCTGCGGAGTTATCCTATATAGCGAAGCCAAGAAACGAAGCAAATGA