Details for Chinese cabbage Locus Brara.A03411

Position : A01 ( 5`- 28046336 .. 28049039 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03411

Protein [Map View]
MTIDPQQKTSKFRWGEMDEDDDLDFLLPPKQVIGPDENGLKTVIEYKFNDEGSKVKITTKSRVRKLASALLNKRAIERRS
WPKFGDAANEDAGGRLTMVSTEEILMERPRAPGTKADESKAAGDSLSQLSKGGAVLMVCRTCHKKGDHWTSKCPYKDLAA
PADVFTDKPPTGETSTVSAAPGTGKAAYVPPSMRAGADRSAGGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPFGAVT
RVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPRPT*

DNA
ATGACGATCGATCCCCAGCAGAAAACGAGCAAGTTCCGATGGGGAGAGATGGACGAAGACGACGACCTCGATTTCCTCCT
CCCTCCCAAGCAAGTGATCGGCCCTGACGAGAACGGATTGAAGACGGTGATCGAGTACAAGTTCAACGACGAAGGGAGCA
AGGTCAAGATCACTACCAAGTCGCGCGTCCGCAAGCTAGCTTCCGCGCTGCTCAACAAACGAGCAATTGAGCGGAGGAGC
TGGCCTAAGTTCGGAGACGCCGCGAACGAGGACGCCGGTGGCCGGCTCACGATGGTGTCGACGGAGGAGATTCTTATGGA
ACGACCTAGGGCTCCTGGTACCAAAGCTGATGAATCAAAGGCAGCTGGAGACAGCTTATCTCAGCTGAGTAAAGGCGGTG
CAGTCCTCATGGTTTGCAGGACATGCCATAAGAAAGGTGATCACTGGACATCAAAATGTCCTTACAAGGATCTAGCTGCA
CCAGCCGATGTCTTTACCGACAAGCCACCCACGGGGGAAACATCTACCGTATCCGCCGCACCTGGAACTGGCAAGGCGGC
TTATGTCCCGCCCAGCATGAGAGCTGGTGCGGACAGAAGCGCTGGTGGCTCGGACATGAGGAGGAGGAACGATGAGAACT
CTGTGCGTGTGACTAACTTGTCTGAAGACACGCGTGAACCGGACTTGATGGAGCTCTTCCACCCGTTTGGAGCTGTCACG
CGTGTCTACGTGGCGATTGATCAGAAGACCGGAGTGAGCAGGGGGTTTGGTTTCGTTAATTTCGTGAGCAGAGAAGACGC
TCAGCGAGCTATTAACAAACTGAATGGTTATGGTTATGATAATCTCATCCTCAGGGTTGAGTGGGCCACTCCAAGACCCA
CCTAG