Details for Chinese cabbage Locus Brara.A03409

Position : A01 ( 5`- 28021561 .. 28024101 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03409

Protein [Map View]
MKLNRGGSGEHGHRHHHEALKFSNFFFMPERPRDYLVLFTRVSVLTCLIFSVSLVLRITFLSSSSAPDYSSSYGLRFSAV
PQKALALPPRRSVGPFNISHVQFCIAGAAETWLDRSRYTSLWWRNSTRGFVWLDKPVKLPKNNSDNRFSIPVRVSDSGWT
RFRFSSSRAAVRIARTIWDSYQLKLPDVRWFVMGDDDTIFFTDNLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFG
GGGFAISRPLAARLAGAMDGCLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIRGDPFGFLAAHPLTPLVSLHHLG
FLDSIFPNKNPIESLQTLMKPYNLDPHRILQQVNCHDRKRQWSISISWGYSIQIYSYFLSAKELEKPLQTFKTWRSLRNG
PFTFNTRPLKPDPCQRPVTYFMDGAEDVRDSGTKTWYSVGDKNYGYCGKREHSRVTRVKRILVTSMKMAPEYLNKAPRRQ
CCEVMDGGGRRKEKEMSIRIRKCRSSETI*

DNA
ATGAAGCTGAATCGCGGTGGCAGCGGAGAGCACGGCCACCGCCACCACCACGAGGCCCTGAAGTTTTCAAATTTCTTTTT
CATGCCGGAGCGGCCACGTGACTACCTCGTGCTTTTCACTCGCGTCTCCGTCCTCACGTGCCTCATCTTCTCCGTCTCTT
TGGTTCTCCGCATCACTTTTCTATCCTCCTCCTCCGCACCGGACTATTCCTCCTCTTACGGTCTCCGTTTCTCCGCCGTT
CCTCAGAAAGCCTTAGCTCTCCCGCCGAGAAGATCCGTCGGTCCGTTCAATATCTCCCACGTTCAGTTCTGTATAGCCGG
AGCAGCTGAGACCTGGCTCGATCGTAGCCGGTACACCTCCTTGTGGTGGCGCAACTCCACACGTGGATTCGTCTGGCTCG
ATAAACCGGTTAAGCTCCCGAAAAATAACTCCGATAACCGGTTCTCGATCCCGGTTCGAGTTTCAGATTCAGGCTGGACC
CGGTTTAGATTTTCCAGCTCGAGAGCCGCGGTTCGGATCGCTAGGACTATATGGGATAGTTACCAACTAAAGCTACCGGA
TGTACGGTGGTTCGTGATGGGAGATGACGACACAATCTTCTTTACAGATAATCTCGTGAAGGTTCTCTCGAAGTACGACC
ACGAGCAGATGTGGTACATTGGTGGAAACTCGGAGAGCGTCGAGCAGGACGTGATGCACGCGTACGATATGGCGTTTGGC
GGTGGCGGTTTCGCGATTAGCCGTCCACTCGCGGCGCGTTTGGCAGGCGCGATGGACGGTTGTCTCCAACGGTATTTTTA
CTTCTACGGTTCGGATCAGAGAATCGCGGCTTGCGTTAGCGAGATCGGCGTTCCGTTCACCGAAGAACGCGGGTTTCATC
AGCTTGACATAAGAGGAGATCCATTTGGGTTTCTAGCAGCACATCCATTGACTCCCCTTGTATCACTGCATCACCTCGGT
TTCTTAGACTCAATATTCCCTAACAAAAACCCTATCGAGTCGCTACAAACCCTAATGAAACCTTACAACTTAGACCCGCA
TCGAATACTCCAGCAGGTTAACTGCCATGACCGCAAGCGTCAGTGGTCTATATCCATTTCTTGGGGATATTCCATTCAGA
TATACTCTTACTTCTTGAGCGCTAAGGAGCTGGAGAAGCCGTTGCAAACCTTCAAAACCTGGCGGTCTTTGAGAAATGGA
CCTTTCACGTTTAACACAAGGCCCTTGAAACCTGACCCGTGTCAGCGTCCCGTCACTTATTTCATGGATGGAGCAGAGGA
TGTGCGGGATAGTGGGACTAAGACTTGGTATAGTGTAGGGGATAAGAATTATGGTTATTGCGGAAAGAGAGAGCATTCTC
GGGTAACTAGGGTGAAGAGGATATTGGTGACTTCAATGAAGATGGCTCCTGAGTATTTGAACAAGGCACCACGGAGACAG
TGTTGCGAGGTGATGGACGGAGGGGGAAGACGAAAAGAGAAAGAAATGTCGATAAGAATTAGAAAGTGCAGATCTTCAGA
GACGATATAA