Details for Chinese cabbage Locus Brara.A03407

Position : A01 ( 5`- 27997536 .. 28000150 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03407

Protein [Map View]
MVEREMSYTMVTDESDDAMYSSIYNESPSAADNIGSGCTSRGKGSVLKKGPWTSTEDGILIDYVKRHGEGNWNTVQKHTS
LARCGKSCRLRWANHLRPNLKKGAFSKEEEQLIVEMHARMGNKWAQMAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPP
GTHVEDLHWSQEYHPSTSNVTDRRRHQDILQLGNSKANVLFDDLTFANVLFEDLNFATSLLPVASDISDMLGTGASSYMS
PILPSHSNIRQAFQSPEHFQNAAPQKNPRSCSISDHPMYGNNHRTDVMIPESHHTFTDGMVPTSKPLFGAVKLELPSFQY
SETSGFDQWTTPSTPQSDLLDSVDTYIQSPPPLEIDEPDCFSSCDTGLLDMLLHEAKIKASAKHSFSSTTCITNGTQNVP
RGGETHIVTSGAAFAVVKTEEMDEVWEPKRADVIRPDVLLESSWQDQQSRFGIVRDSSSLSDALSLLLGG*

DNA
ATGGTTGAAAGAGAGATGAGTTACACGATGGTGACGGATGAGAGTGATGACGCTATGTACTCAAGCATCTACAACGAGTC
ACCATCTGCTGCTGATAACATTGGCAGTGGCTGCACAAGCAGAGGGAAAGGAAGTGTCCTGAAGAAAGGGCCCTGGACCT
CAACGGAAGACGGGATTTTGATTGATTATGTCAAGAGGCACGGCGAGGGTAACTGGAACACTGTGCAGAAACACACCAGC
CTTGCACGTTGTGGTAAAAGCTGTCGTCTCAGGTGGGCTAATCATCTCAGGCCGAACTTGAAGAAAGGAGCGTTTAGCAA
AGAGGAAGAACAGCTTATCGTCGAAATGCACGCTAGGATGGGCAATAAATGGGCACAGATGGCTGAACATTTGCCTGGGA
GAACAGATAATGAGATAAAGAATTATTGGAACACGCGTATCAAGAGGCGGCAACGAGCAGGCTTACCACTTTACCCTCCT
GGAACCCATGTTGAAGACCTGCACTGGAGTCAAGAGTATCATCCATCAACGAGTAATGTCACCGATAGAAGAAGACATCA
AGACATCTTGCAATTGGGAAACTCCAAAGCTAATGTTCTGTTTGACGATCTAACCTTTGCTAATGTCCTCTTTGAGGATC
TAAATTTCGCTACTAGCTTGTTACCTGTAGCTTCTGACATCTCAGATATGTTAGGCACTGGTGCAAGTAGCTACATGTCA
CCAATATTGCCTTCCCACAGTAACATAAGGCAAGCATTCCAATCCCCAGAACATTTTCAGAACGCTGCTCCACAGAAGAA
TCCAAGATCTTGCAGTATCTCTGATCATCCTATGTATGGAAACAATCATCGAACCGATGTGATGATTCCAGAAAGCCATC
ATACCTTTACGGATGGCATGGTTCCTACTTCTAAGCCCTTGTTTGGGGCGGTGAAACTGGAGCTCCCTTCATTCCAATAT
TCAGAAACTAGTGGATTTGATCAGTGGACGACACCGTCAACTCCACAATCAGATCTACTGGACTCTGTTGATACTTATAT
TCAATCTCCACCACCGTTGGAGATAGATGAGCCAGATTGTTTCTCCTCATGCGACACCGGCCTGCTAGATATGCTGCTTC
ATGAAGCCAAGATCAAAGCTAGTGCGAAGCACAGTTTCAGTTCAACTACTTGTATAACCAATGGTACTCAGAATGTACCA
CGTGGAGGTGAAACCCATATTGTCACATCAGGTGCAGCTTTTGCAGTTGTGAAGACGGAAGAGATGGATGAGGTATGGGA
ACCAAAGAGAGCTGATGTAATACGGCCTGATGTTTTACTGGAGTCGAGCTGGCAAGACCAGCAAAGCCGTTTTGGGATTG
TTAGAGACTCAAGCAGCTTGAGCGACGCCCTTTCGCTTCTTCTTGGTGGGTGA