Details for Chinese cabbage Locus Brara.A03404

Position : A01 ( 5`- 27990257 .. 27991642 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03404

Protein [Map View]
MSRRKTREPKEETVTLGPAVRDGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDV
AQRCKELGITAMHVKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL*

DNA
ATGTCGAGGAGAAAGACCAGAGAGCCCAAGGAGGAAACCGTCACACTCGGACCTGCTGTTCGTGACGGAGAGCAAGTGTT
CGGTGTTGTTCACATCTTTGCTTCTTTCAATGACACTTTCATTCACGTTACTGATCTGTCGGGAAGAGAAACTCTCGTCC
GTATCACCGGTGGGATGAAGGTGAAGGCTGACCGTGATGAGTCGTCTCCTTATGCTGCTATGCTTGCCGCTCAAGATGTT
GCTCAAAGATGCAAGGAGCTTGGCATTACTGCGATGCACGTGAAGCTCCGTGCCACTGGAGGAAACAAAACAAAGACTCC
AGGACCTGGTGCTCAGTCAGCTCTCAGAGCCCTTGCTCGTTCTGGCATGAAGATTGGTCGTATTGAGGATGTGACTCCGG
TTCCCACCGACAGTACACGTAGAAAGGGTGGACGAAGAGGAAGAAGACTCTGA