Details for Chinese cabbage Locus Brara.A03401

Position : A01 ( 5`- 27970539 .. 27972703 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03401

Protein [Map View]
MSGNHYSRDIHHNTPSVHHHQNYAVVDREYLFEKSLTPSDVGKLNRLVIPKQHAEKHFPLNNAGDDVAAAETTEKGMLLT
FEDESGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLHAGDVVFFQRHRFDLHRVFIGWRKRGEVSSPTAVSVVSQEARV
NTTAYWSGLTTPYRQVHASTSSYPNIHQEYSHYGAVAEIPTVVTGSSRTVRLFGVNLECHGDVVETPPCPDGYNGQHFYY
YSTPDPMNISFAGEAMEQVGDGRR*

DNA
ATGTCAGGCAACCATTACTCAAGAGACATCCACCACAACACTCCCTCGGTGCACCATCACCAAAACTACGCCGTTGTTGA
TAGAGAGTATTTATTCGAGAAATCACTAACCCCAAGCGACGTCGGAAAGCTAAACCGTTTAGTCATACCGAAACAACACG
CCGAGAAACACTTCCCTCTCAATAATGCCGGGGATGACGTGGCGGCGGCGGAGACGACGGAGAAAGGGATGCTTCTTACC
TTCGAGGACGAGTCAGGCAAGTGTTGGAAATTCAGATACTCGTATTGGAACAGTAGCCAAAGCTACGTGTTGACCAAAGG
ATGGAGCAGGTACGTGAAAGACAAACACCTCCACGCAGGGGACGTTGTTTTCTTTCAGCGGCACCGTTTTGATCTACATA
GAGTCTTCATTGGTTGGCGAAAACGCGGCGAGGTTTCTTCCCCTACCGCCGTCTCCGTCGTGTCTCAAGAGGCACGAGTT
AACACGACGGCGTACTGGAGCGGCTTGACTACACCTTACCGTCAAGTACACGCGTCAACTAGTTCTTACCCTAACATTCA
CCAAGAGTATTCACACTATGGCGCTGTCGCTGAGATACCGACGGTTGTTACAGGGAGCTCGAGGACGGTGAGGCTATTTG
GAGTTAATCTCGAATGTCACGGTGACGTTGTCGAGACACCACCGTGTCCGGACGGCTACAATGGCCAACACTTTTACTAT
TACTCAACTCCTGATCCCATGAATATCTCATTTGCTGGAGAAGCAATGGAACAGGTAGGAGATGGACGACGTTGA